Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against OXR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 705-874 of human OXR1(NP_001185461.1?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against OXR1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 705-874 of human OXR1(NP_001185461.1?) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15453A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | OXR1 |
| Target Synonyms | TLDC3; CHEGDD; Nbla00307; OXR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 705-874 of human OXR1(NP_001185461.1?). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTPVLMVIKDSDGQVFGALASEPLKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMDSLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNRTLSKKEDFFIQDIEIWAFE | Uniprot ID | Q8N573 |
Uniprot Id
Q8N573
Target Species
Human
Target Name
OXR1
Target Full Name
Oxidation resistance protein 1
Target Function
May be involved in protection from oxidative damage.
Target Subcellular Location
Mitochondrion.
Target Protein Families
OXR1 family
Target Synonyms
C7; C7B; Gm1238; Nbla00307; Nucleolar protein C7; Oxidation resistance 1; Oxidation resistance protein 1; Oxr1; OXR1_HUMAN; Putative protein product of Nbla00307; rCG_59825
Target Background
Predicted to enable oxidoreductase activity. Predicted to be involved in response to oxidative stress. Predicted to act upstream of or within several processes, including adult walking behavior; negative regulation of neuron death; and negative regulation of peptidyl-cysteine S-nitrosylation. Predicted to be located in mitochondrion and nucleolus. Predicted to be active in nucleus. Implicated in cerebellar hyplasia/atrophy, epilepsy, and global developmental delay.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
