-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PAI-1/Serpin E1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PAI-1/Serpin E1 (P05121) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PAI-1/Serpin E1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human PAI-1/Serpin E1 (P05121) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16547A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PAI-1/Serpin E1 |
| Target Synonyms | PAI; PAI1; PAI-1; PLANH1; PAI-1/Serpin E1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human PAI-1/Serpin E1 (P05121). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVDFS | Uniprot ID | P05121 |
Uniprot Id
P05121
Target Species
Human
Target Name
SERPINE1
Target Full Name
Plasminogen activator inhibitor 1
Target Function
Serine protease inhibitor. Inhibits TMPRSS7. Is a primary inhibitor of tissue-type plasminogen activator (PLAT) and urokinase-type plasminogen activator (PLAU). As PLAT inhibitor, it is required for fibrinolysis down-regulation and is responsible for the controlled degradation of blood clots. As PLAU inhibitor, it is involved in the regulation of cell adhesion and spreading. Acts as a regulator of cell migration, independently of its role as protease inhibitor. It is required for stimulation of keratinocyte migration during cutaneous injury repair. It is involved in cellular and replicative senescence. Plays a role in alveolar type 2 cells senescence in the lung. Is involved in the regulation of cementogenic differentiation of periodontal ligament stem cells, and regulates odontoblast differentiation and dentin formation during odontogenesis.
Target Involvement
Plasminogen activator inhibitor-1 deficiency (PAI-1D)
Target Subcellular Location
Secreted.
Target Protein Families
Serpin family
Target Tissue Specificity
Expressed in endothelial cells. Found in plasma, platelets, and hepatoma and fibrosarcoma cells.
Target Research Area
Cardiovascular
Target Synonyms
Clade E; Endothelial plasminogen activator inhibitor; Nexin ; Nexin plasminogen activator inhibitor type 1; PAI 1; PAI; PAI-1; PAI1_HUMAN; PLANH1; Plasminogen activator inhibitor 1; Plasminogen activator inhibitor type 1; Serine (or cysteine) proteinase inhibitor ; Serine (or cysteine) proteinase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1; Serine proteinase inhibitor clade E member 1; serpin; Serpin E1; Serpin peptidase inhibitor clade E (nexin plasminogen activator inhibitor type 1) member 1; Serpin peptidase inhibitor clade E; Serpine 1; SERPINE1
Target Background
This gene encodes a member of the serine proteinase inhibitor (serpin) superfamily. This member is the principal inhibitor of tissue plasminogen activator (tPA) and urokinase (uPA), and hence is an inhibitor of fibrinolysis. The protein also functions as a component of innate antiviral immunity. Defects in this gene are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1 deficiency), and high concentrations of the gene product are associated with thrombophilia.
Notification