-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Palladin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Palladin (NP_001159582.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Palladin was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Palladin (NP_001159582.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15359A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Palladin |
| Target Synonyms | MYN; PNCA1; CGI151; SIH002; CGI-151; Palladin | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Palladin (NP_001159582.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGTSSHESFYDSLSDMQEESKNTDFFPGLSAFLSQEEINKSLDLARRAIADSETEDFDSEKEISQIFSTSPASLCEHPSHKETKLGEHASRRPQDNRST | Uniprot ID | Q8WX93 |
Uniprot Id
Q8WX93
Target Species
Human
Target Name
PALLD
Target Full Name
Palladin
Target Function
Cytoskeletal protein required for organization of normal actin cytoskeleton. Roles in establishing cell morphology, motility, cell adhesion and cell-extracellular matrix interactions in a variety of cell types. May function as a scaffolding molecule with the potential to influence both actin polymerization and the assembly of existing actin filaments into higher-order arrays. Binds to proteins that bind to either monomeric or filamentous actin. Localizes at sites where active actin remodeling takes place, such as lamellipodia and membrane ruffles. Different isoforms may have functional differences. Involved in the control of morphological and cytoskeletal changes associated with dendritic cell maturation. Involved in targeting ACTN to specific subcellular foci.
Target Involvement
Pancreatic cancer 1 (PNCA1)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell junction, focal adhesion. Cytoplasm, myofibril, sarcomere, Z line. Cell projection, ruffle. Cell projection, podosome. Cell projection, lamellipodium. Cell projection, axon. Cell projection, growth cone.
Target Protein Families
Myotilin/palladin family
Target Tissue Specificity
Detected in both muscle and non-muscle tissues. High expression in prostate, ovary, colon, and kidney. Not detected in spleen, skeletal muscle, lung and peripheral blood lymphocytes (at protein level). Protein is overexpressed in FA6, HPAF, IMIM-PC2, SUIT
Target Synonyms
PALLD; KIAA0992; CGI-151Palladin; SIH002; Sarcoma antigen NY-SAR-77
Target Background
This gene encodes a cytoskeletal protein that is required for organizing the actin cytoskeleton. The protein is a component of actin-containing microfilaments, and it is involved in the control of cell shape, adhesion, and contraction. Polymorphisms in this gene are associated with a susceptibility to pancreatic cancer type 1, and also with a risk for myocardial infarction. Alternative splicing results in multiple transcript variants.
Notification