-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PARP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 484-583 of human PARP2 (Q9UGN5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PARP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 484-583 of human PARP2 (Q9UGN5) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14311A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PARP2 |
| Target Synonyms | ARTD2; ADPRT2; PARP-2; ADPRTL2; ADPRTL3; pADPRT-2; PARP2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 484-583 of human PARP2 (Q9UGN5). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLLLSEVALGQCNELLEANPKAEGLLQGKHSTKGLGKMAPSSAHFVTLNGSTVPLGPASDTGILNPDGYTLNYNEYIVYNPNQVRMRYLLKVQFNFLQLW | Uniprot ID | Q9UGN5 |
Uniprot Id
Q9UGN5
Target Species
Human
Target Name
PARP2
Target Full Name
Poly [ADP-ribose] polymerase 2
Target Function
Poly-ADP-ribosyltransferase that mediates poly-ADP-ribosylation of proteins and plays a key role in DNA repair. Mediates glutamate, aspartate or serine ADP-ribosylation of proteins: the ADP-D-ribosyl group of NAD(+) is transferred to the acceptor carboxyl group of target residues and further ADP-ribosyl groups are transferred to the 2'-position of the terminal adenosine moiety, building up a polymer with an average chain length of 20-30 units. Serine ADP-ribosylation of proteins constitutes the primary form of ADP-ribosylation of proteins in response to DNA damage. Mediates glutamate and aspartate ADP-ribosylation of target proteins in absence of HPF1. Following interaction with HPF1, catalyzes serine ADP-ribosylation of target proteins; HPF1 conferring serine specificity by completing the PARP2 active site. PARP2 initiates the repair of double-strand DNA breaks: recognizes and binds DNA breaks within chromatin and recruits HPF1, licensing serine ADP-ribosylation of target proteins, such as histones, thereby promoting decompaction of chromatin and the recruitment of repair factors leading to the reparation of DNA strand breaks. In addition to proteins, also able to ADP-ribosylate DNA: preferentially acts on 5'-terminal phosphates at DNA strand breaks termini in nicked duplex.
Target Subcellular Location
Nucleus. Chromosome.
Target Tissue Specificity
Widely expressed, mainly in actively dividing tissues. The highest levels are in the brain, heart, pancreas, skeletal muscle and testis; also detected in kidney, liver, lung, placenta, ovary and spleen; levels are low in leukocytes, colon, small intestine
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
ADP ribosyltransferase like 2; ADP-ribosyltransferase diphtheria toxin-like 2; ADPRT 2; ADPRT-2; ADPRT2; ADPRTL 2; ADPRTL 3; ADPRTL2; ADPRTL3; ARTD2; hPARP 2; hPARP-2; hPARP2; NAD(+) ADP ribosyltransferase 2; NAD(+) ADP-ribosyltransferase 2; pADPRT 2; pADPRT-2; pADPRT2; PARP 2; PARP-2; PARP2; PARP2_HUMAN; Poly (ADP ribose) polymerase family member 2; Poly (ADP ribosyl) transferase like 2; poly (ADP-ribose) polymerase 2; Poly [ADP ribose] synthetase 2; Poly [ADP-ribose] polymerase 2; Poly(ADP ribose) synthetase; Poly[ADP-ribose] synthase 2
Target Background
This gene encodes poly(ADP-ribosyl)transferase-like 2 protein, which contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of the protein. Two alternatively spliced transcript variants encoding distinct isoforms have been found.
Notification