Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PDCD7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDCD7 (Q8N8D1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PDCD7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDCD7 (Q8N8D1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13229A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PDCD7 |
| Target Synonyms | 59K; ES18; HES18; PDCD7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse testis, Mouse thymus, SK-OV-3, TE-1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PDCD7 (Q8N8D1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALPPFFGQGRPGPPPPQPPPPAPFGCPPPPLPSPAFPPPLPQRPGPFPGASAPFLQPPLALQPRASAEASRGGGGAGAFYPVPPPPLPPPPPQCRPFPG | Uniprot ID | Q8N8D1 |
Uniprot Id
Q8N8D1
Target Species
Human
Target Name
PDCD7
Target Full Name
Programmed cell death protein 7
Target Function
Promotes apoptosis when overexpressed.
Target Subcellular Location
Nucleus.
Target Synonyms
Apoptosis-related protein ES18 ; ES18; HES18; MGC22015; Pdcd7; PDCD7_HUMAN; Programmed cell death 7 ; Programmed cell death protein 7
Target Background
This gene encodes a 59 kDa protein that is associated with the U11 small nuclear ribonucleoprotein (snRNP), which is a component of the minor U12-type spliceosome responsible for catalyzing pre-mRNA splicing of U12-type introns.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
