-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PKA C-beta (PRKACB) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 251-351 of human PKA C-beta (PRKACB) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PKA C-beta (PRKACB) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 251-351 of human PKA C-beta (PRKACB) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-15019A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PKA C-beta (PRKACB) |
| Target Synonyms | CAFD2; PKA C-beta (PRKACB) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, 293T, Mouse brain, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 251-351 of human PKA C-beta (PRKACB). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF | Uniprot ID | P22694 |
Uniprot Id
P22694
Target Species
Human
Target Name
PRKACB
Target Full Name
cAMP-dependent protein kinase catalytic subunit beta
Target Function
Mediates cAMP-dependent signaling triggered by receptor binding to GPCRs. PKA activation regulates diverse cellular processes such as cell proliferation, the cell cycle, differentiation and regulation of microtubule dynamics, chromatin condensation and decondensation, nuclear envelope disassembly and reassembly, as well as regulation of intracellular transport mechanisms and ion flux. Regulates the abundance of compartmentalized pools of its regulatory subunits through phosphorylation of PJA2 which binds and ubiquitinates these subunits, leading to their subsequent proteolysis. Phosphorylates GPKOW which regulates its ability to bind RNA.
Target Subcellular Location
Cytoplasm. Cell membrane. Membrane; Lipid-anchor. Nucleus.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, cAMP subfamily
Target Tissue Specificity
Isoform 1 is most abundant in the brain, with low level expression in kidney. Isoform 2 is predominantly expressed in thymus, spleen and kidney. Isoform 3 and isoform 4 are only expressed in the brain.
Target Synonyms
cAMP-dependent protein kinase catalytic beta subunit isoform 4ab; cAMP-dependent protein kinase catalytic subunit beta; KAPCB_HUMAN; PKA C beta; PKA C-beta; PKACB; Prkacb; protein kinase A catalytic subunit beta; Protein kinase cAMP dependent catalytic beta
Target Background
The protein encoded by this gene is a member of the serine/threonine protein kinase family. The encoded protein is a catalytic subunit of cAMP (cyclic AMP)-dependent protein kinase, which mediates signalling though cAMP. cAMP signaling is important to a number of processes, including cell proliferaton and differentiation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed.
Notification