Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PLC beta 3 (PLCB3) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human PLC beta 3 (PLC beta 3 (PLCB3)) (Q01970) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PLC beta 3 (PLCB3) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human PLC beta 3 (PLC beta 3 (PLCB3)) (Q01970) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14249A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PLC beta 3 (PLCB3) |
| Target Synonyms | SMDCD; PLC beta 3 (PLCB3) | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, OVCAR3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1100-1200 of human PLC beta 3 (PLC beta 3 (PLCB3)) (Q01970). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLEEAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG | Uniprot ID | Q01970 |
Uniprot Id
Q01970
Target Species
Human
Target Name
PLCB3
Target Full Name
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
Target Function
The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes.
Target Subcellular Location
Cytoplasm. Membrane. Nucleus.
Target Synonyms
SMDCD; Phospho-PLC beta 3 (PLCB3)-S1105
Target Background
This gene encodes a member of the phosphoinositide phospholipase C beta enzyme family that catalyze the production of the secondary messengers diacylglycerol and inositol 1, 4, 5-triphosphate from phosphatidylinositol in G-protein-linked receptor-mediated signal transduction. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
