-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PODXL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-479 of human PODXL (O00592) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PODXL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-479 of human PODXL (O00592) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13193A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PODXL |
| Target Synonyms | PC; PDX; PCLP; Gp200; gp135; PCLP-1; PODXL1; PODXL | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HCT 116, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-479 of human PODXL (O00592). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRFSMPLIITIVCMASFLLLVAAL | Uniprot ID | O00592 |
Uniprot Id
O00592
Target Species
Human
Target Name
PODXL
Target Full Name
Podocalyxin
Target Function
Involved in the regulation of both adhesion and cell morphology and cancer progression. Functions as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up initial epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.
Target Subcellular Location
Apical cell membrane. Cell projection, lamellipodium. Cell projection, filopodium. Cell projection, ruffle. Cell projection, microvillus. Membrane raft. Membrane; Single-pass type I membrane protein.
Target Protein Families
Podocalyxin family
Target Tissue Specificity
Glomerular epithelium cell (podocyte).
Target Research Area
Cancer
Target Synonyms
GCTM-2 antigen; Gp2; Gp200; MGC138240; PC; PCLP; PCLP-1; PCLP1; Pcx; Podocalyxin; Podocalyxin like; Podocalyxin like protein; Podocalyxin-like protein 1; Podxl; PODXL_HUMAN
Target Background
This gene encodes a member of the sialomucin protein family. The encoded protein was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the encoded protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.
Notification