-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PREB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 89-201 of human PREB (NP_037520.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PREB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 89-201 of human PREB (NP_037520.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13264A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PREB |
| Target Synonyms | SEC12; PREB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Hep G2, K-562, MCF7, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 89-201 of human PREB (NP_037520.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HCQLLRFQAHQQQGNKAEKAGSKEQGPRQRKGAAPAEKKCGAETQHEGLELRVENLQAVQTDFSSDPLQKVVCFNHDNTLLATGGTDGYVRVWKVPSLEKVLEFKAHEGEIED | Uniprot ID | Q9HCU5 |
Uniprot Id
Q9HCU5
Target Species
Human
Target Name
PREB
Target Full Name
Guanine nucleotide-exchange factor SEC12
Target Function
Guanine nucleotide exchange factor that specifically activates the small GTPase SAR1B. Mediates the recruitment of SAR1B and other COPII coat components to endoplasmic reticulum membranes and is therefore required for the formation of COPII transport vesicles from the ER.; Was first identified based on its probable role in the regulation of pituitary gene transcription. Binds to the prolactin gene (PRL) promoter and seems to activate transcription.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus.
Target Tissue Specificity
Ubiquitous.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Mammalian guanine nucleotide exchange factor mSec12; Preb; PREB_HUMAN; Prolactin regulatory binding element protein; Prolactin regulatory element binding; Prolactin regulatory element binding protein; Prolactin regulatory element-binding protein; SEC12
Target Background
This gene encodes a protein that specifically binds to a Pit1-binding element of the prolactin (PRL) promoter. This protein may act as a transcriptional regulator and is thought to be involved in some of the developmental abnormalities observed in patients with partial trisomy 2p. This gene overlaps the abhydrolase domain containing 1 (ABHD1) gene on the opposite strand.
Notification