-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSMA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-150 of human PSMA3 (P25788) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PSMA3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-150 of human PSMA3 (P25788) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13937A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSMA3 |
| Target Synonyms | HC8; PSC3; PSMA3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, Rat brain, HL-60, HT-29, MCF7, PC-12, RAW264.7 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-150 of human PSMA3 (P25788). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLY | Uniprot ID | P25788 |
Uniprot Id
P25788
Target Species
Human
Target Name
PSMA3
Target Full Name
Proteasome subunit alpha type-3
Target Function
Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex). Binds to the C-terminus of CDKN1A and thereby mediates its degradation. Negatively regulates the membrane trafficking of the cell-surface thromboxane A2 receptor (TBXA2R) isoform 2.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Peptidase T1A family
Target Synonyms
HC8; Macropain subunit C8; MGC12306; MGC32631; Multicatalytic endopeptidase complex subunit C8; Proteasome (prosome macropain) subunit alpha type 3; Proteasome alpha 3 subunit; Proteasome component C8; Proteasome subunit alpha type 3; Proteasome subunit alpha type-3; Proteasome subunit C8; PSA3_HUMAN; PSC8; psmA3
Target Background
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
Notification