-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP1 (NP_114368.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against PTBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP1 (NP_114368.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-15715A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTBP1 |
| Target Synonyms | PTB; PTB2; PTB3; PTB4; pPTB; HNRPI; PTB-1; PTB-T; HNRNPI; HNRNP-I; P1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTBP1 (NP_114368.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDGIVPDIAVGTKRGSDELFSTCVTNGPFIMSSNSASAANGNDSKKFKGDSRSAGVPSRVIHIRKLPIDVTEGEVISLGLPFGKVTNLLMLKGKNQAFIE | Uniprot ID | P26599 |
Uniprot Id
P26599
Target Species
Human
Target Name
PTBP1
Target Full Name
Polypyrimidine tract-binding protein 1
Target Function
Plays a role in pre-mRNA splicing and in the regulation of alternative splicing events. Activates exon skipping of its own pre-mRNA during muscle cell differentiation. Binds to the polypyrimidine tract of introns. May promote RNA looping when bound to two separate polypyrimidine tracts in the same pre-mRNA. May promote the binding of U2 snRNP to pre-mRNA. Cooperates with RAVER1 to modulate switching between mutually exclusive exons during maturation of the TPM1 pre-mRNA. Represses the splicing of MAPT/Tau exon 10. In case of infection by picornaviruses, binds to the viral internal ribosome entry site (IRES) and stimulates the IRES-mediated translation.
Target Subcellular Location
Nucleus.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
57 kDa RNA binding protein PPTB 1; 57 kDa RNA-binding protein PPTB-1; Heterogeneous nuclear ribonucleoprotein I; Heterogeneous Nuclear Ribonucleoprotein Polypeptide I; hnRNP I; HNRNP-I; HNRNPI; HNRPI; MGC10830; MGC8461; Polypyrimidine tract binding protein (heterogeneous nuclear ribonucleoprotein I); Polypyrimidine Tract Binding Protein 1; Polypyrimidine tract binding protein; Polypyrimidine tract-binding protein 1; pPTB; PTB 1; PTB 2; PTB 3; PTB 4; PTB; PTB T; PTB1; PTB2; PTB3; PTB4; PTBP 1; PTBP1; PTBP1_HUMAN; PTBT; RNA Binding Protein
Target Background
This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA-binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has four repeats of quasi-RNA recognition motif (RRM) domains that bind RNAs. This protein binds to the intronic polypyrimidine tracts that requires pre-mRNA splicing and acts via the protein degradation ubiquitin-proteasome pathway. It may also promote the binding of U2 snRNP to pre-mRNAs. This protein is localized in the nucleoplasm and it is also detected in the perinucleolar structure. Alternatively spliced transcript variants encoding different isoforms have been described.
Notification