-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB5A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 115-215 of human RAB5A (NP_004153.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RAB5A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 115-215 of human RAB5A (NP_004153.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15429A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB5A |
| Target Synonyms | RAB5A; RAB5; ras-related protein Rab-5A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 115-215 of human RAB5A (NP_004153.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN | Uniprot ID | P20339 |
Uniprot Id
P20339
Target Species
Human
Target Name
RAB5A
Target Full Name
Ras-related protein Rab-5A
Target Function
Small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, binds to a variety of effector proteins to regulate cellular responses such as of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Active GTP-bound form is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. RAB5A is required for the fusion of plasma membranes and early endosomes. Contributes to the regulation of filopodia extension. Required for the exosomal release of SDCBP, CD63, PDCD6IP and syndecan. Regulates maturation of apoptotic cell-containing phagosomes, probably downstream of DYN2 and PIK3C3.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Early endosome membrane; Lipid-anchor. Melanosome. Cytoplasmic vesicle. Cell projection, ruffle. Membrane. Cytoplasm, cytosol. Cytoplasmic vesicle, phagosome membrane. Endosome membrane.
Target Protein Families
Small GTPase superfamily, Rab family
Target Research Area
Developmental Biology
Target Synonyms
RAB 5; RAB 5A; RAB5A; RAB5A member RAS oncogene family; RAB5A_HUMAN; RAS associated protein RAB5A; Ras related protein Rab 5A; Ras-related protein Rab-5A
Target Background
Enables GDP binding activity; GTP binding activity; and GTPase activity. Involved in several processes, including amyloid-beta clearance by transcytosis; early endosome to late endosome transport; and regulation of exocytosis. Located in several cellular components, including cytoplasmic side of early endosome membrane; nucleoplasm; and terminal bouton.
Notification