-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RALBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human RALBP1 (Q15311) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RALBP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human RALBP1 (Q15311) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14214A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RALBP1 |
| Target Synonyms | RIP1; RLIP1; RLIP76; RALBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human RALBP1 (Q15311). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKV | Uniprot ID | Q15311 |
Uniprot Id
Q15311
Target Species
Human
Target Name
RALBP1
Target Full Name
RalA-binding protein 1
Target Function
Multifunctional protein that functions as a downstream effector of RALA and RALB. As a GTPase-activating protein/GAP can inactivate CDC42 and RAC1 by stimulating their GTPase activity. As part of the Ral signaling pathway, may also regulate ligand-dependent EGF and insulin receptors-mediated endocytosis. During mitosis, may act as a scaffold protein in the phosphorylation of EPSIN/EPN1 by the mitotic kinase cyclin B-CDK1, preventing endocytosis during that phase of the cell cycle. During mitosis, also controls mitochondrial fission as an effector of RALA. Recruited to mitochondrion by RALA, acts as a scaffold to foster the mitotic kinase cyclin B-CDK1-mediated phosphorylation and activation of DNM1L.; Could also function as a primary ATP-dependent active transporter for glutathione conjugates of electrophiles. May also actively catalyze the efflux of a wide range of substrates including xenobiotics like doxorubicin (DOX) contributing to cell multidrug resistance.
Target Subcellular Location
Cell membrane; Peripheral membrane protein. Cytoplasm, cytosol. Cytoplasm, cytoskeleton, spindle pole. Nucleus. Mitochondrion.
Target Tissue Specificity
Expressed ubiquitously but at low levels. Shows a strong expression in the erythrocytes.
Target Synonyms
RLIP1; 76 kDa Ral-interacting protein; 76-kDa Ral-interacting protein; Dinitrophenyl S-glutathione ATPase; DNP-SG ATPase; Ral-interacting protein 1; Ral-interacting protein 1, 76-KD; RalA-binding protein 1; RalBP1; RBP1_HUMAN; RIP1; RLIP1; RLIP76
Target Background
RALBP1 plays a role in receptor-mediated endocytosis and is a downstream effector of the small GTP-binding protein RAL (see RALA; MIM 179550). Small G proteins, such as RAL, have GDP-bound inactive and GTP-bound active forms, which shift from the inactive to the active state through the action of RALGDS (MIM 601619), which in turn is activated by RAS (see HRAS; MIM 190020) (summary by Feig, 2003 [PubMed 12888294]).
Notification