-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Rap1GAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rap1GAP (P47736) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Rap1GAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rap1GAP (P47736) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14155A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAP1GAP |
| Target Synonyms | RAPGAP; RAP1GA1; RAP1GAP1; RAP1GAPII; Rap1GAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, BxPC-3, Mouse brain, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rap1GAP (P47736). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MIEKMQGSRMDEQRCSFPPPLKTEEDYIPYPSVHEVLGREGPFPLILLPQFGGYWIEGTNHEITSIPETEPLQSPTTKVKLECNPTARIYRKHFLGKEHF | Uniprot ID | P47736 |
Uniprot Id
P47736
Target Species
Human
Target Name
RAP1GAP
Target Full Name
Rap1 GTPase-activating protein 1
Target Function
GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.
Target Subcellular Location
Golgi apparatus membrane; Peripheral membrane protein.
Target Tissue Specificity
Significant expression seen in the brain, kidney and pancreas. Abundant in the cerebral cortex and expressed at much lower levels in the spinal cord. Not detected in the lymphoid tissues.
Target Research Area
Cancer
Target Synonyms
KIAA0474; Rap1 GTPase activating protein 1; RAP1 GTPase activating protein; Rap1 GTPase-activating protein 1; RAP1GA1; Rap1ga1 protein; Rap1GAP; Rap1GAP1; RAP1GAPII; RAPGAP; RPGP1_HUMAN
Target Background
This gene encodes a type of GTPase-activating-protein (GAP) that down-regulates the activity of the ras-related RAP1 protein. RAP1 acts as a molecular switch by cycling between an inactive GDP-bound form and an active GTP-bound form. The product of this gene, RAP1GAP, promotes the hydrolysis of bound GTP and hence returns RAP1 to the inactive state whereas other proteins, guanine nucleotide exchange factors (GEFs), act as RAP1 activators by facilitating the conversion of RAP1 from the GDP- to the GTP-bound form. In general, ras subfamily proteins, such as RAP1, play key roles in receptor-linked signaling pathways that control cell growth and differentiation. RAP1 plays a role in diverse processes such as cell proliferation, adhesion, differentiation, and embryogenesis. Alternative splicing results in multiple transcript variants encoding distinct proteins.
Notification