-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RhoGDI was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoGDI (P52565) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RhoGDI was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoGDI (P52565) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17175A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RhoGDI |
| Target Synonyms | GDIA1; NPHS8; RHOGDI; RHOGDI-1; HEL-S-47e; DI | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, 293T, Mouse brain, Rat liver, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 70-150 of human RhoGDI (P52565). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VVVTGLTLVCSSAPGPLELDLTGDLESFKKQSFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYG | Uniprot ID | P52565 |
Uniprot Id
P52565
Target Species
Human
Target Name
ARHGDIA
Target Full Name
Rho GDP-dissociation inhibitor 1
Target Function
Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.
Target Involvement
Nephrotic syndrome 8 (NPHS8)
Target Subcellular Location
Cytoplasm.
Target Protein Families
Rho GDI family
Target Research Area
Signal Transduction
Target Synonyms
ARHGDIA; fa96g11; GDIA 1; GDIA1; GDIR1_HUMAN; MGC117248; NPHS8; Rho GDI 1; Rho GDI alpha; Rho GDI; Rho GDP dissociation inhibitor (GDI) alpha ; Rho GDP dissociation inhibitor 1; Rho GDP dissociation inhibitor alpha; Rho GDP-dissociation inhibitor 1; Rho-GDI alpha; RhoGDI 1; RhoGDI alpha; RHOGDI; RhoGDI1; wu:fa96g11; zgc:55554; zgc:77681
Target Background
This gene encodes a protein that plays a key role in the regulation of signaling through Rho GTPases. The encoded protein inhibits the disassociation of Rho family members from GDP (guanine diphosphate), thereby maintaining these factors in an inactive state. Activity of this protein is important in a variety of cellular processes, and expression of this gene may be altered in tumors. Mutations in this gene have been found in individuals with nephrotic syndrome, type 8. Alternate splicing results in multiple transcript variants.
Notification