-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100/S100A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-94 of human S100/S100A1 (P23297) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against S100/S100A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-94 of human S100/S100A1 (P23297) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13632A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100/S100A1 |
| Target Synonyms | S100; S100A; S100-alpha; S100/S100A1 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-94 of human S100/S100A1 (P23297). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS | Uniprot ID | P23297 |
Uniprot Id
P23297
Target Species
Human
Target Name
S100A1
Target Full Name
Protein S100-A1
Target Function
Small calcium binding protein that plays important roles in several biological processes such as Ca(2+) homeostasis, chondrocyte biology and cardiomyocyte regulation. In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers conformational changes. These changes allow interactions with specific target proteins and modulate their activity. Regulates a network in cardiomyocytes controlling sarcoplasmic reticulum Ca(2+) cycling and mitochondrial function through interaction with the ryanodine receptors RYR1 and RYR2, sarcoplasmic reticulum Ca(2+)-ATPase/ATP2A2 and mitochondrial F1-ATPase. Facilitates diastolic Ca(2+) dissociation and myofilament mechanics in order to improve relaxation during diastole.
Target Subcellular Location
Cytoplasm. Sarcoplasmic reticulum. Mitochondrion.
Target Protein Families
S-100 family
Target Tissue Specificity
Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain.
Target Research Area
Signal Transduction
Target Synonyms
Bpb; NEF; Protein S100-A1; S-100 protein alpha chain; S-100 protein subunit alpha; S100 alpha; S100 beta; S100 calcium binding protein A1; S100 calcium binding protein B; S100 calcium-binding protein A1; S100 protein alpha polypeptide; S100A; s100a1; S100B; S100beta; S10A1_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-induced Ca2+ release, inhibition of microtubule assembly, and inhibition of protein kinase C-mediated phosphorylation. Reduced expression of this protein has been implicated in cardiomyopathies.
Notification