-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S6 Ribosomal Protein (RPS6) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against S6 Ribosomal Protein (RPS6) was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16752A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S6 Ribosomal Protein (RPS6) |
| Target Synonyms | S6; eS6; S6 Ribosomal Protein (RPS6) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Mouse liver, Mouse thymus, Rat liver | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP | Uniprot ID | P62753 |
Uniprot Id
P62753
Target Species
Human
Target Name
RPS6
Target Full Name
Small ribosomal subunit protein eS6
Target Function
Component of the 40S small ribosomal subunit. Plays an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.
Target Protein Families
Eukaryotic ribosomal protein eS6 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
40S ribosomal protein S6; Air8; NP33; Phosphoprotein NP33; Pp30; Ribosomal protein S6; RP S6; rps6; RS6; RS6_HUMAN; S6; S6 Ribosomal Protein
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Notification