-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SMPD3/NSMase2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 461-655 of human SMPD3/NSMase2 (NP_061137.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SMPD3/NSMase2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 461-655 of human SMPD3/NSMase2 (NP_061137.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15252A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SMPD3/NSMase2 |
| Target Synonyms | NSMASE2; SMPD3/NSMase2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HL-60(Negative control), Rat lung, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 461-655 of human SMPD3/NSMase2 (NP_061137.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HLHAPQEDSAIRCGQLDLLQDWLADFRKSTSSSSAANPEELVAFDVVCGDFNFDNCSSDDKLEQQHSLFTHYRDPCRLGPGEEKPWAIGTLLDTNGLYDEDVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLKGNGRRIDYMLHAEEGLCPDWKAEVEEFSFITQLSGLTDHLPVAMRLMVSSGEEEA | Uniprot ID | Q9NY59 |
Uniprot Id
Q9NY59
Target Species
Human
Target Name
SMPD3
Target Full Name
Sphingomyelin phosphodiesterase 3
Target Function
Catalyzes the hydrolysis of sphingomyelin to form ceramide and phosphocholine. Ceramide mediates numerous cellular functions, such as apoptosis and growth arrest, and is capable of regulating these 2 cellular events independently. Also hydrolyzes sphingosylphosphocholine. Regulates the cell cycle by acting as a growth suppressor in confluent cells. Probably acts as a regulator of postnatal development and participates in bone and dentin mineralization. Binds to anionic phospholipids (APLs) such as phosphatidylserine (PS) and phosphatidic acid (PA) that modulate enzymatic activity and subcellular location. May be involved in IL-1-beta-induced JNK activation in hepatocytes. May act as a mediator in transcriptional regulation of NOS2/iNOS via the NF-kappa-B activation under inflammatory conditions.
Target Subcellular Location
Golgi apparatus membrane; Lipid-anchor. Cell membrane; Lipid-anchor. Note=May localize to detergent-resistant subdomains of Golgi membranes of hypothalamic neurosecretory neurons (PubMed:10823942). Localizes to plasma membrane in confluent contact-inhaibited cells (PubMed:15051724).
Target Protein Families
Neutral sphingomyelinase family
Target Tissue Specificity
Predominantly expressed in brain.
Target Research Area
Neuroscience
Target Synonyms
Cca1; Confluent 3Y1 cell-associated protein 1; Neutral sphingomyelinase 2; Neutral sphingomyelinase II; NSMA2_HUMAN; nSMase-2; nSMase2; SMPD3; Sphingomyelin phosphodiesterase 3; sphingomyelin phosphodiesterase 3, neutral membrane (neutral sphingomyelinase II)
Target Background
Predicted to enable phosphatidic acid binding activity; phosphatidylserine binding activity; and sphingomyelin phosphodiesterase activity. Predicted to be involved in positive regulation of exosomal secretion and sphingomyelin metabolic process. Predicted to act upstream of or within several processes, including animal organ development; enzyme linked receptor protein signaling pathway; and sphingolipid metabolic process. Predicted to be located in Golgi apparatus and plasma membrane. Predicted to be active in cytoplasm. Biomarker of pulmonary emphysema.
Notification