Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SNRPA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 156-255 of human SNRPA1 (P09661) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SNRPA1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 156-255 of human SNRPA1 (P09661) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16669A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SNRPA1 |
| Target Synonyms | Lea1; U2A'; SNRPA1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse brain, Mouse liver, Mouse pancreas, RD, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 156-255 of human SNRPA1 (P09661). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QEAEKMFKGKRGAQLAKDIARRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQSGQIPGRERRSGPTDDGEEEMEEDTVTNGS | Uniprot ID | P09661 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
