-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Sprouty 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 216-315 of human Sprouty 2 (O43597) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Sprouty 2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 216-315 of human Sprouty 2 (O43597) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13452A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Sprouty 2 |
| Target Synonyms | IGAN3; hSPRY2; Sprouty 2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 216-315 of human Sprouty 2 (O43597). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GTCVCCVKGLFYHCSNDDEDNCADNPCSCSQSHCCTRWSAMGVMSLFLPCLWCYLPAKGCLKLCQGCYDRVNRPGCRCKNSNTVCCKVPTVPPRNFEKPT | Uniprot ID | O43597 |
Uniprot Id
O43597
Target Species
Human
Target Name
SPRY2
Target Full Name
Protein sprouty homolog 2
Target Function
Antagonist of fibroblast growth factor (FGF) pathways via inhibition of FGF-mediated phosphorylation of ERK1/2. Thereby acts as an antagonist of FGF-induced retinal lens fiber differentiation, may inhibit limb bud outgrowth and may negatively modulate respiratory organogenesis. Inhibits TGFB-induced epithelial-to-mesenchymal transition in retinal lens epithelial cells. Inhibits CBL/C-CBL-mediated EGFR ubiquitination.
Target Involvement
IgA nephropathy 3 (IGAN3)
Target Subcellular Location
Cytoplasm, cytoskeleton. Cell projection, ruffle membrane.
Target Protein Families
Sprouty family
Target Research Area
Cardiovascular
Target Synonyms
hSPRY 2; hSPRY2; MGC23039; Protein sprouty homolog 2; Sprouty 2; Sprouty homolog 2 (Drosophila); Sprouty homolog 2; Sprouty2; Spry 2; Spry-2; SPRY2; SPY2_HUMAN
Target Background
This gene encodes a protein belonging to the sprouty family. The encoded protein contains a carboxyl-terminal cysteine-rich domain essential for the inhibitory activity on receptor tyrosine kinase signaling proteins and is required for growth factor stimulated translocation of the protein to membrane ruffles. In primary dermal endothelial cells this gene is transiently upregulated in response to fibroblast growth factor two. This protein is indirectly involved in the non-cell autonomous inhibitory effect on fibroblast growth factor two signaling. The protein interacts with Cas-Br-M (murine) ectropic retroviral transforming sequence, and can function as a bimodal regulator of epidermal growth factor receptor/mitogen-activated protein kinase signaling. This protein may play a role in alveoli branching during lung development as shown by a similar mouse protein.
Notification