-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against STAT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT1 (P42224) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ChIP-seq, ELISA.
The antibody against STAT1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT1 (P42224) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ChIP-seq, ELISA.
| Cat.No | ADA-17085A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | STAT1 |
| Target Synonyms | CANDF7; IMD31A; IMD31B; IMD31C; ISGF-3; STAT91; STAT1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, Mouse thymus, Rat liver | Application | ELISA, WB, ChIP, ChIP-seq, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human STAT1 (P42224). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQ | Uniprot ID | P42224 |
Uniprot Id
P42224
Target Species
Human
Target Name
STAT1
Target Full Name
Signal transducer and activator of transcription 1-alpha/beta
Target Function
Signal transducer and transcription activator that mediates cellular responses to interferons (IFNs), cytokine KITLG/SCF and other cytokines and other growth factors. Following type I IFN (IFN-alpha and IFN-beta) binding to cell surface receptors, signaling via protein kinases leads to activation of Jak kinases (TYK2 and JAK1) and to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize and associate with ISGF3G/IRF-9 to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of IFN-stimulated genes (ISG), which drive the cell in an antiviral state. In response to type II IFN (IFN-gamma), STAT1 is tyrosine- and serine-phosphorylated. It then forms a homodimer termed IFN-gamma-activated factor (GAF), migrates into the nucleus and binds to the IFN gamma activated sequence (GAS) to drive the expression of the target genes, inducing a cellular antiviral state. Becomes activated in response to KITLG/SCF and KIT signaling. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4.
Target Involvement
Immunodeficiency 31B (IMD31B); Immunodeficiency 31A (IMD31A); Immunodeficiency 31C (IMD31C)
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Transcription factor STAT family
Target Synonyms
Signal transducer and activator of transcription 1 91kD; CANDF7; DKFZp686B04100; IMD31A; IMD31B; IMD31C; ISGF 3; ISGF-3; OTTHUMP00000163552; OTTHUMP00000165046; OTTHUMP00000165047; OTTHUMP00000205845; Signal transducer and activator of transcription 1 91kDa; Signal transducer and activator of transcription 1; Signal transducer and activator of transcription 1, 91kD; Signal transducer and activator of transcription 1-alpha/beta; STAT 1; Stat1; STAT1_HUMAN; STAT91; Transcription factor ISGF 3 components p91 p84; Transcription factor ISGF-3 components p91/p84; Transcription factor ISGF3 components p91/p84; XStat1
Target Background
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. The protein encoded by this gene can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. The protein plays an important role in immune responses to viral, fungal and mycobacterial pathogens. Mutations in this gene are associated with Immunodeficiency 31B, 31A, and 31C.
Notification