Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Syntaxin 3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Syntaxin 3 (Q13277) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Syntaxin 3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Syntaxin 3 (Q13277) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14164A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Syntaxin 3 |
| Target Synonyms | MVID2; STX3A; DIAR12; RDMVID; Syntaxin 3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-29, PC-12 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Syntaxin 3 (Q13277). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KHIEEDEVRSSADLRIRKSQHSVLSRKFVEVMTKYNEAQVDFRERSKGRIQRQLEITGKKTTDEELEEMLESGNPAIFTSGIIDSQISKQALSEIEGRHKD | Uniprot ID | Q13277 |
Uniprot Id
Q13277
Target Species
Human
Target Name
STX3
Target Full Name
Syntaxin-3
Target Function
Potentially involved in docking of synaptic vesicles at presynaptic active zones.
Target Subcellular Location
Membrane; Single-pass type IV membrane protein.
Target Protein Families
Syntaxin family
Target Synonyms
FLJ30906; Stx3; STX3_HUMAN; STX3A; Syntaxin 3A ; Syntaxin-3
Target Background
The gene is a member of the syntaxin family. The encoded protein is targeted to the apical membrane of epithelial cells where it forms clusters and is important in establishing and maintaining polarity necessary for protein trafficking involving vesicle fusion and exocytosis. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
