-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TCL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human TCL1 (NP_068801.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against TCL1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human TCL1 (NP_068801.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-15621A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TCL1 |
| Target Synonyms | TCL1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Daudi, Ramos | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human TCL1 (NP_068801.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD | Uniprot ID | P56279 |
Uniprot Id
P56279
Target Species
Human
Target Name
TCL1A
Target Full Name
T-cell leukemia/lymphoma protein 1A
Target Function
Enhances the phosphorylation and activation of AKT1, AKT2 and AKT3. Promotes nuclear translocation of AKT1. Enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival.
Target Involvement
Chromosomal aberrations activating TCL1A are found in chronic T-cell leukemias (T-CLL). Translocation t(14;14)(q11;q32); translocation t(7;14)(q35;q32); inversion inv(14)(q11;q32) that involves the T-cell receptor alpha/delta loci.
Target Subcellular Location
Cytoplasm. Nucleus. Microsome. Endoplasmic reticulum. Note=Microsomal fraction.
Target Protein Families
TCL1 family
Target Tissue Specificity
Restricted in the T-cell lineage to immature thymocytes and activated peripheral lymphocytes. Preferentially expressed early in T- and B-lymphocyte differentiation.
Target Synonyms
Anti TCL1A; Lymphoma/leukemia, T-cell; Oncogene TCL-1; Oncogene TCL1; P14 TCL1; P14 TCL1 protein; Protein p14 TCL1; T cell leukemia 1; T cell lymphoma 1; T cell lymphoma 1A; T-cell leukemia/lymphoma 1A; T-cell leukemia/lymphoma protein 1A; TCL 1 protein; TCL1; TCL1 oncogene; TCL1 PEN; Tcl1a; TCL1A; TCL1A_HUMAN
Target Background
Overexpression of the TCL1 gene in humans has been implicated in the development of mature T cell leukemia, in which chromosomal rearrangements bring the TCL1 gene in close proximity to the T-cell antigen receptor (TCR)-alpha (MIM 186880) or TCR-beta (MIM 186930) regulatory elements (summarized by Virgilio et al., 1998 [PubMed 9520462]). In normal T cells TCL1 is expressed in CD4-/CD8- cells, but not in cells at later stages of differentiation. TCL1 functions as a coactivator of the cell survival kinase AKT (MIM 164730) (Laine et al., 2000 [PubMed 10983986]).
Notification