-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TGF beta induced (TGFBI) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human TGF beta induced (TGFBI) (NP_000349.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TGF beta induced (TGFBI) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-650 of human TGF beta induced (TGFBI) (NP_000349.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14695A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TGF beta induced (TGFBI) |
| Target Synonyms | CSD; CDB1; CDG2; CSD1; CSD2; CSD3; EBMD; LCD1; BIGH3; CDGG1; TGF beta induced (TGFBI) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293F, A549, Rat kidney, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 550-650 of human TGF beta induced (TGFBI) (NP_000349.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LPPRERSRLLGDAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA | Uniprot ID | Q15582 |
Uniprot Id
Q15582
Target Species
Human
Target Name
TGFBI
Target Full Name
Transforming growth factor-beta-induced protein ig-h3
Target Function
Plays a role in cell adhesion. May play a role in cell-collagen interactions.
Target Involvement
Corneal dystrophy, epithelial basement membrane (EBMD); Corneal dystrophy, Groenouw type 1 (CDGG1); Corneal dystrophy, lattice type 1 (CDL1); Corneal dystrophy, Thiel-Behnke type (CDTB); Corneal dystrophy, Reis-Bucklers type (CDRB); Corneal dystrophy, lattice type 3A (CDL3A); Corneal dystrophy, Avellino type (CDA)
Target Subcellular Location
Secreted. Secreted, extracellular space, extracellular matrix.
Target Tissue Specificity
Highly expressed in the corneal epithelium. Expressed in heart, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
RGD containing collagen associated protein; AI181842; AI747162; Beta ig; Beta ig h3; Beta ig-h3; BGH3_HUMAN; Big h3; BIGH3; CDB1; CDG2; CDGG1; CSD; CSD1; CSD2; CSD3; EBMD; Kerato epithelin; Kerato-epithelin; LCD1; MGC150270; RGD CAP; RGD-CAP; RGD-containing collagen-associated protein; TGFBI; TGFBI transforming growth factor, beta induced, 68kDa; Transforming growth factor beta induced protein ig h3; Transforming growth factor-beta-induced protein ig-h3
Target Background
This gene encodes an RGD-containing protein that binds to type I, II and IV collagens. The RGD motif is found in many extracellular matrix proteins modulating cell adhesion and serves as a ligand recognition sequence for several integrins. This protein plays a role in cell-collagen interactions and may be involved in endochondrial bone formation in cartilage. The protein is induced by transforming growth factor-beta and acts to inhibit cell adhesion. Mutations in this gene are associated with multiple types of corneal dystrophy.
Notification