Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Thyroid Peroxidase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thyroid Peroxidase (P07202) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against Thyroid Peroxidase was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thyroid Peroxidase (P07202) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using Thyroid Peroxidase Rabbit mAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
| Cat.No | ADA-14386A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Thyroid Peroxidase |
| Target Synonyms | MSA; TPX; TDH2A; Thyroid Peroxidase | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Thyroid Peroxidase (P07202). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQRNLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQA | Uniprot ID | P07202 |
Uniprot Id
P07202
Target Species
Human
Target Name
TPO
Target Full Name
Thyroid peroxidase
Target Function
Iodination and coupling of the hormonogenic tyrosines in thyroglobulin to yield the thyroid hormones T(3) and T(4).
Target Involvement
Thyroid dyshormonogenesis 2A (TDH2A)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell surface.
Target Protein Families
Peroxidase family, XPO subfamily
Target Research Area
Cancer
Target Synonyms
MSA ; PERT_HUMAN; TDH2A; Thyroid microsomal antigen; Thyroid peroxidase; Thyroperoxidase; TPO; TPX
Target Background
This gene encodes a membrane-bound glycoprotein. The encoded protein acts as an enzyme and plays a central role in thyroid gland function. The protein functions in the iodination of tyrosine residues in thyroglobulin and phenoxy-ester formation between pairs of iodinated tyrosines to generate the thyroid hormones, thyroxine and triiodothyronine. Mutations in this gene are associated with several disorders of thyroid hormonogenesis, including congenital hypothyroidism, congenital goiter, and thyroid hormone organification defect IIA. Multiple transcript variants encoding distinct isoforms have been identified for this gene, but the full-length nature of some variants has not been determined.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
