-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Timeless was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1058-1208 of human Timeless (Q9UNS1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Timeless was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1058-1208 of human Timeless (Q9UNS1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14439A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIMELESS |
| Target Synonyms | TIM; TIM1; hTIM; FASPS4; TIMELESS | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-549, Hep G2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1058-1208 of human Timeless (Q9UNS1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EQFQQLLRKLGVRPPASGQETFWRIPAKLSPTQLRRAAASLSQPEEEQKLQPELQPKVPGEQGSDEEHCKEHRAQALRALLLAHKKKAGLASPEEEDAVGKEPLKAAPKKRQLLDSDEEQEEDEGRNRAPELGAPGIQKKKRYQIEDDEDD | Uniprot ID | Q9UNS1 |
Uniprot Id
Q9UNS1
Target Species
Human
Target Name
TIMELESS
Target Full Name
Protein timeless homolog
Target Function
Plays an important role in the control of DNA replication, maintenance of replication fork stability, maintenance of genome stability throughout normal DNA replication, DNA repair and in the regulation of the circadian clock. Required to stabilize replication forks during DNA replication by forming a complex with TIPIN: this complex regulates DNA replication processes under both normal and stress conditions, stabilizes replication forks and influences both CHEK1 phosphorylation and the intra-S phase checkpoint in response to genotoxic stress. TIMELESS promotes TIPIN nuclear localization. Involved in cell survival after DNA damage or replication stress by promoting DNA repair. In response to double-strand breaks (DSBs), accumulates at DNA damage sites and promotes homologous recombination repair via its interaction with PARP1. May be specifically required for the ATR-CHEK1 pathway in the replication checkpoint induced by hydroxyurea or ultraviolet light. Involved in the determination of period length and in the DNA damage-dependent phase advancing of the circadian clock. Negatively regulates CLOCK|NPAS2-ARTNL/BMAL1|ARTNL2/BMAL2-induced transactivation of PER1 possibly via translocation of PER1 into the nucleus. May also play an important role in epithelial cell morphogenesis and formation of branching tubules.
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Timeless family
Target Tissue Specificity
Expressed in all tissues examined including brain, heart, lung, liver, skeletal muscle, kidney, placenta, pancreas, spleen, thymus and testis. Highest levels of expression in placenta, pancreas, thymus and testis.
Target Synonyms
FLJ12640; FLJ20714; hTIM; Protein timeless homolog; TIM; TIM_HUMAN; TIM1; Timeless; timeless circadian clock 1; timeless circadian clock; timeless homolog; TIMELESS1; Tof1 homolog
Target Background
The protein encoded by this gene is highly conserved and is involved in cell survival after damage or stress, increase in DNA polymerase epsilon activity, maintenance of telomere length, and epithelial cell morphogenesis. The encoded protein also plays a role in the circadian rhythm autoregulatory loop, interacting with the PERIOD genes (PER1, PER2, and PER3) and others to downregulate activation of PER1 by CLOCK/ARNTL. Changes in this gene or its expression may promote prostate cancer, lung cancer, breast cancer, and mental disorders.
Notification