-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIN2/TINF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-309 of human TIN2/TINF2 (Q9BSI4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TIN2/TINF2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 210-309 of human TIN2/TINF2 (Q9BSI4) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16212A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIN2/TINF2 |
| Target Synonyms | TIN2; DKCA3; TIN2/TINF2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, Hep G2, Mouse testis, Mouse thymus, Rat lung, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 210-309 of human TIN2/TINF2 (Q9BSI4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NLAEPMEQNPPQQQRLALHNPLPKAKPGTHLPQGPSSRTHPEPLAGRHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISKPESKEEH | Uniprot ID | Q9BSI4 |
Uniprot Id
Q9BSI4
Target Species
Human
Target Name
TINF2
Target Full Name
TERF1-interacting nuclear factor 2
Target Function
Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Plays a role in shelterin complex assembly. Isoform 1 may have additional role in tethering telomeres to the nuclear matrix.
Target Involvement
Dyskeratosis congenita, autosomal dominant, 3 (DKCA3); Dyskeratosis congenita, autosomal dominant, 5 (DKCA5)
Target Subcellular Location
Nucleus. Chromosome, telomere. Note=Associated with telomeres.; [Isoform 1]: Nucleus matrix.
Target Tissue Specificity
Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
Target Synonyms
AW552114; D14Wsu146e; DKCA3; MGC94711; TERF 1 (TRF 1) interacting nuclear factor 2; TERF 1 interacting nuclear factor 2; TERF1 (TRF1) interacting nuclear factor 2; TERF1 interacting nuclear factor 2; TERF1-interacting nuclear factor 2; Tin 2; TIN2; TINF 2; Tinf2; TINF2_HUMAN; TRF 1 interacting nuclear factor 2; TRF1 interacting nuclear factor 2; TRF1-interacting nuclear protein 2
Target Background
This gene encodes one of the proteins of the shelterin, or telosome, complex which protects telomeres by allowing the cell to distinguish between telomeres and regions of DNA damage. The protein encoded by this gene is a critical part of shelterin; it interacts with the three DNA-binding proteins of the shelterin complex, and it is important for assembly of the complex. Mutations in this gene cause dyskeratosis congenita (DKC), an inherited bone marrow failure syndrome.
Notification