-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TIRAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIRAP (P58753) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TIRAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIRAP (P58753) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16218A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TIRAP |
| Target Synonyms | Mal; wyatt; BACTS1; MyD88-2; TIRAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Hep G2, Mouse brain, Rat spleen, Rat thymus, THP-1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TIRAP (P58753). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASSTSLPAPGSRPKKPLGKMADWFRQTLLKKPKKRPNSPESTSSDASQPTSQDSPLPPSLSSVTSPSLPPTHASDSGSSRWSKDYDVCVCHSEEDLVAA | Uniprot ID | P58753 |
Uniprot Id
P58753
Target Species
Human
Target Name
TIRAP
Target Full Name
Toll/interleukin-1 receptor domain-containing adapter protein
Target Function
Adapter involved in TLR2 and TLR4 signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response. Positively regulates the production of TNF-alpha and interleukin-6.
Target Subcellular Location
Cytoplasm. Cell membrane. Membrane. Note=Colocalizes with DAB2IP at the plasma membrane.
Target Tissue Specificity
Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain.
Target Research Area
Immunology
Target Synonyms
TIRAP; MAL; Toll/interleukin-1 receptor domain-containing adapter protein; TIR domain-containing adapter protein; Adaptor protein Wyatt; MyD88 adapter-like protein; MyD88-2
Target Background
The innate immune system recognizes microbial pathogens through Toll-like receptors (TLRs), which identify pathogen-associated molecular patterns. Different TLRs recognize different pathogen-associated molecular patterns and all TLRs have a Toll-interleukin 1 receptor (TIR) domain, which is responsible for signal transduction. The protein encoded by this gene is a TIR adaptor protein involved in the TLR4 signaling pathway of the immune system. It activates NF-kappa-B, MAPK1, MAPK3 and JNK, which then results in cytokine secretion and the inflammatory response. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.
Notification