Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TPMT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TPMT (P51580) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against TPMT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human TPMT (P51580) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13399A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TPMT |
| Target Synonyms | TPMTD; TPMT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T, Hep G2, K-562, Mouse brain, Mouse liver, Rat kidney, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human TPMT (P51580). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KKHLDTFLKGKSGLRVFFPLCGKAVEMKWFADRGHSVVGVEISELGIQEFFTEQNLSYSEEPITEIPGTKVFKSSSGNISLYCCSIFDLPRTNIGKFDMIW | Uniprot ID | P51580 |
Uniprot Id
P51580
Target Species
Human
Target Name
TPMT
Target Full Name
Thiopurine S-methyltransferase
Target Function
Catalyzes the S-methylation of thiopurine drugs such as 6-mercaptopurine (also called mercaptopurine, 6-MP or its brand name Purinethol) and 6-thioguanine (also called tioguanine or 6-TG) using S-adenosyl-L-methionine as the methyl donor. TPMT activity modulates the cytotoxic effects of thiopurine prodrugs. A natural substrate for this enzyme has yet to be identified.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Class I-like SAM-binding methyltransferase superfamily, TPMT family
Target Research Area
Metabolism
Target Synonyms
HGNC:12014; S adenosyl L methionine thiopurine S methyltransferase; Thiopurine methyltransferase; Thiopurine S methyltransferase; Thiopurine S-methyltransferase; TPMT; TPMT_HUMAN
Target Background
This gene encodes the enzyme that metabolizes thiopurine drugs via S-adenosyl-L-methionine as the S-methyl donor and S-adenosyl-L-homocysteine as a byproduct. Thiopurine drugs such as 6-mercaptopurine are used as chemotherapeutic agents. Genetic polymorphisms that affect this enzymatic activity are correlated with variations in sensitivity and toxicity to such drugs within individuals, causing thiopurine S-methyltransferase deficiency. Related pseudogenes have been identified on chromosomes 3, 18 and X.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
