-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Transportin 3 (TNPO3) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 824-923 of human Transportin 3 (Transportin 3 (TNPO3)) (Q9Y5L0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Transportin 3 (TNPO3) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 824-923 of human Transportin 3 (Transportin 3 (TNPO3)) (Q9Y5L0) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14282A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Transportin 3 (TNPO3) |
| Target Synonyms | IPO12; TRNSR; LGMD1F; LGMDD2; MTR10A; TRN-SR; TRN-SR2; Transportin 3 (TNPO3) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, Mouse lung, Mouse testis, Mouse thymus, Rat testis, RD | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Transportin 3 (Transportin 3 (TNPO3)) (Q9Y5L0). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QVMNQLGQQLVSQLLHTCCFCLPPYTLPDVAEVLWEIMQVDRPTFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQVCWALRDFTRLFR | Uniprot ID | Q9Y5L0 |
Uniprot Id
Q9Y5L0
Target Species
Human
Target Name
TNPO3
Target Full Name
Transportin-3
Target Function
Importin, which transports target proteins into the nucleus. Specifically mediates the nuclear import of splicing factor serine/arginine (SR) proteins, such as RBM4, SFRS1 and SFRS2, by recognizing phosphorylated SR domains. Also mediates the nuclear import of serine/arginine (SR) protein CPSF6, independently of CPSF6 phosphorylation. The nuclear import process is regulated by the small GTPase Ran that partitions between cytoplasm and nucleus in the predominantly GDP- and GTP-bound form, respectively. Importin associates with target cargo proteins in the cytoplasm, and the competitive binding of GTP-bound Ran induces the release of cargos in the nucleus.; (Microbial infection) Involved in immunodeficiency virus (HIV-1) infection by importing the pre-integration complex (PIC) into the nucleus. Required for a nuclear maturation step of HIV-1 prior to integration.
Target Involvement
Limb-girdle muscular dystrophy 1F (LGMD1F)
Target Subcellular Location
Nucleus envelope. Cytoplasm.
Target Tissue Specificity
Expressed in skeletal muscle.
Target Synonyms
IPO12; TRNSR; LGMD1F; LGMDD2; MTR10A; TRN-SR; TRN-SR2; Transportin 3 (TNPO3)
Target Background
The protein encoded by this gene is a nuclear import receptor for serine/arginine-rich (SR) proteins such as the splicing factors SFRS1 and SFRS2. The encoded protein has also been shown to be involved in HIV-1 infection, apparently through interaction with the HIV-1 capsid protein. Several protein-coding and non-coding transcript variants have been found for this gene.
Notification