-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ube1L / UBA7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Ube1L / UBA7 (NP_003326.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Ube1L / UBA7 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Ube1L / UBA7 (NP_003326.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15330A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ube1L / UBA7 |
| Target Synonyms | D8; UBE2; UBE7; UBA1B; UBE1L; Ube1L / UBA7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HEL | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Ube1L / UBA7 (NP_003326.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDALDASKLLDEELYSRQLYVLGSPAMQRIQGARVLVSGLQGLGAEVAKNLVLMGVGSLTLHDPHPTCWSDLAAQFLLSEQDLERSRAEASQELLAQLNR | Uniprot ID | P41226 |
Uniprot Id
P41226
Target Species
Human
Target Name
UBA7
Target Full Name
Ubiquitin-like modifier-activating enzyme 7
Target Function
Activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding a ubiquitin-E1 thioester and free AMP. Catalyzes the ISGylation of influenza A virus NS1 protein.
Target Protein Families
Ubiquitin-activating E1 family
Target Tissue Specificity
Expressed in a variety of normal and tumor cell types, but is reduced in lung cancer cell lines.
Target Synonyms
D8; MGC12713; UBA1, ubiquitin activating enzyme E1 homolog B; UBA1B; UBA7; UBA7, ubiquitin activating enzyme E1; UBA7_HUMAN; Ube 1L; UBE 2; UBE1L; UBE2; Ubiquitin activating enzyme 2; Ubiquitin activating enzyme E1 homolog; Ubiquitin Activating Enzyme E1 Like; Ubiquitin activating enzyme E1 related protein; Ubiquitin-activating enzyme 7; Ubiquitin-activating enzyme E1 homolog; ubiquitin-activating enzyme-2; ubiquitin-like modifier activating enzyme 7; Ubiquitin-like modifier-activating enzyme 7
Target Background
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme is a retinoid target that triggers promyelocytic leukemia (PML)/retinoic acid receptor alpha (RARalpha) degradation and apoptosis in acute promyelocytic leukemia, where it is involved in the conjugation of the ubiquitin-like interferon-stimulated gene 15 protein.
Notification