Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against UBE4A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE4A (Q14139) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against UBE4A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE4A (Q14139) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16666A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | UBE4A |
| Target Synonyms | E4; UFD2; UBOX2; NEDHMS; UBE4A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, Mouse brain, PUMC-HUVEC-T1, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBE4A (Q14139). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTDQENNNNISSNPFAALFGSLADAKQFAAIQKEQLKQQSDELPASPDDSDNSVSESLDEFDYSVAEISRSFRSQQEICEQLNINHMIQRIFLITLDNSD | Uniprot ID | Q14139 |
Uniprot Id
Q14139
Target Species
Human
Target Name
UBE4A
Target Full Name
Ubiquitin conjugation factor E4 A
Target Function
Ubiquitin-protein ligase that probably functions as an E3 ligase in conjunction with specific E1 and E2 ligases. May also function as an E4 ligase mediating the assembly of polyubiquitin chains on substrates ubiquitinated by another E3 ubiquitin ligase. Mediates 'Lys-48'-linked polyubiquitination of substrates.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Ubiquitin conjugation factor E4 family
Target Synonyms
E4; KIAA0126; MGC133315; UBE4A; UBE4A_HUMAN; Ubiquitin conjugation factor E4 A; ubiquitination factor E4A (UFD2 homolog yeast); Ubiquitination factor E4A; UBOX2; UFD2; UFD2 homolog; UFD2b
Target Background
This gene encodes a member of the U-box ubiquitin ligase family. The encoded protein is involved in multiubiquitin chain assembly and plays a critical role in chromosome condensation and separation through the polyubiquitination of securin. Autoantibodies against the encoded protein may be markers for scleroderma and Crohn's disease. A pseudogene of this gene is located on the long arm of chromosome 3. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
