-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against WAPL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WAPL (Q7Z5K2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against WAPL was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human WAPL (Q7Z5K2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-14328A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | WAPL |
| Target Synonyms | FOE; WAPAL; KIAA0261; WAPL | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, C2C12, Jurkat, RD | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human WAPL (Q7Z5K2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPKKPKVEEESTGDPFGFDSDDESLPVSSKNLAQVKCSSYSES | Uniprot ID | Q7Z5K2 |
Uniprot Id
Q7Z5K2
Target Species
Human
Target Name
WAPL
Target Full Name
Wings apart-like protein homolog
Target Function
Regulator of sister chromatid cohesion in mitosis which negatively regulates cohesin association with chromatin. Involved in both sister chromatid cohesion during interphase and sister-chromatid resolution during early stages of mitosis. Couples DNA replication to sister chromatid cohesion. Cohesion ensures that chromosome partitioning is accurate in both meiotic and mitotic cells and plays an important role in DNA repair.
Target Subcellular Location
[Isoform 2]: Nucleus.; Nucleus. Chromosome. Cytoplasm. Note=Associates with chromatin through the cohesin complex during interphase. Released in the cytoplasm from nuclear envelope breakdown until anaphase, it reaccumulates in nucleus at telophase.
Target Protein Families
WAPL family
Target Tissue Specificity
Isoform 1 is highly expressed in uterine cervix tumor. Isoform 2 is widely expressed with a high level in skeletal muscle and heart.
Target Synonyms
FOE; Friend of EBNA2 (Epstein Barr virus nuclear protein 2); Friend of EBNA2 protein; KIAA0261; OTTHUMP00000020004; WAPAL; WAPL; WAPL_HUMAN; Wings apart like homolog; Wings apart like homolog (Drosophila); Wings apart-like protein homolog
Target Background
Involved in several processes, including negative regulation of DNA replication; negative regulation of chromatin binding activity; and regulation of sister chromatid cohesion. Located in several cellular components, including Golgi apparatus; intercellular bridge; and microtubule cytoskeleton.
Notification