-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against YY1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY1 (P25490) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ChIP, ELISA.
The antibody against YY1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY1 (P25490) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ChIP, ELISA.
| Cat.No | ADA-16756A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | YY1 |
| Target Synonyms | DELTA; NF-E1; UCRBP; GADEVS; INO80S; YIN-YANG-1; YY1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Jurkat, Mouse liver, Raji, U-251MG | Application | ELISA, WB, ChIP, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human YY1 (P25490). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH | Uniprot ID | P25490 |
Uniprot Id
P25490
Target Species
Human
Target Name
YY1
Target Full Name
Transcriptional repressor protein YY1
Target Function
Multifunctional transcription factor that exhibits positive and negative control on a large number of cellular and viral genes by binding to sites overlapping the transcription start site. Binds to the consensus sequence 5'-CCGCCATNTT-3'; some genes have been shown to contain a longer binding motif allowing enhanced binding; the initial CG dinucleotide can be methylated greatly reducing the binding affinity. The effect on transcription regulation is depending upon the context in which it binds and diverse mechanisms of action include direct activation or repression, indirect activation or repression via cofactor recruitment, or activation or repression by disruption of binding sites or conformational DNA changes. Its activity is regulated by transcription factors and cytoplasmic proteins that have been shown to abrogate or completely inhibit YY1-mediated activation or repression. For example, it acts as a repressor in absence of adenovirus E1A protein but as an activator in its presence. Acts synergistically with the SMAD1 and SMAD4 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression. Binds to SMAD binding elements (SBEs) (5'-GTCT/AGAC-3') within BMP response element (BMPRE) of cardiac activating regions. May play an important role in development and differentiation. Proposed to recruit the PRC2/EED-EZH2 complex to target genes that are transcriptional repressed. Involved in DNA repair. In vitro, binds to DNA recombination intermediate structures (Holliday junctions). Plays a role in regulating enhancer activation.; Proposed core component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair; proposed to target the INO80 complex to YY1-responsive elements.
Target Involvement
Gabriele-de Vries syndrome (GADEVS)
Target Subcellular Location
Nucleus matrix. Note=Associated with the nuclear matrix.
Target Protein Families
YY transcription factor family
Target Synonyms
CF1; Delta; Delta transcription factor; INO80 complex subunit S; INO80S; NF E1; NF-E1; NFE1; OTTHUMP00000197459; Transcriptional repressor protein YY1; TYY1_HUMAN; UCR motif DNA binding protein; UCRBP; Yin and yang 1; Yin and Yang 1 protein; Yin Yang 1; Ying Yang 1; YY 1; YY 1 transcription factor; YY-1; YY1; YY1 transcription factor
Target Background
YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1.
Notification