Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ICOS/CD278 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-142 of mouse ICOS/CD278(NP_059508.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.
The antibody against ICOS/CD278 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-142 of mouse ICOS/CD278(NP_059508.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, FC, ELISA.
Western blot analysis of lysates from wild type (WT) and CHO cells transfected with CD278 using CD278 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit.
Exposure time: 180s.
| Cat.No | ADA-15442A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ICOS/CD278 |
| Target Synonyms | H4; CCLP; AILIM; CRP-1; Ly115; ICOS/CD278 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Transfected CHO whole cell extracts. | Application | ELISA, WB, FC, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-142 of Mouse ICOS/CD278(NP_059508.2). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | EINGSADHRMFSFHNGGVQISCKYPETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQGSYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKL | Uniprot ID | Q9WVS0 |
Uniprot Id
Q9WVS0
Target Synonyms
H4; CCLP; AILIM; CRP-1; Ly115
Target Background
Predicted to be involved in T cell costimulation; T cell tolerance induction; and cell-cell adhesion. Located in external side of plasma membrane. Is integral component of plasma membrane. Used to study common variable immunodeficiency. Human ortholog(s) of this gene implicated in celiac disease; common variable immunodeficiency; and immunoglobulin alpha deficiency. Orthologous to human ICOS (inducible T cell costimulator).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
