Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ly-6A/E (Sca-1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Ly-6A/E (Sca-1) (P05533) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Ly-6A/E (Sca-1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Ly-6A/E (Sca-1) (P05533) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14293A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Ly-6A/E (Sca-1) |
| Target Synonyms | TAP; Sca1; Sca-1; Ly-6A.2; Ly-6A/E; Ly-6E.1; Ly-6A/E (Sca-1) | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse lung, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse Ly-6A/E (Sca-1) (P05533). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | MDTSHTTKSCLLILLVALLCAERAQGLECYQCYGVPFETSCPSITCPYPDGVCVTQEAAVIVDSQTRKVKNNLCLPICPPNIESMEILGTKVNVKTSCCQ | Uniprot ID | P05533 |
Uniprot Id
P05533
Target Species
Mouse
Target Name
LY6A
Target Full Name
Lymphocyte antigen 6A-2/6E-1
Target Function
T-cell activation.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Tissue Specificity
Widely expressed.
Target Synonyms
TAP; Sca1; Sca-1; Ly-6A.2; Ly-6A/E; Ly-6E.1; Ly-6A/E (Sca-1)
Target Background
Predicted to enable acetylcholine receptor binding activity and acetylcholine receptor inhibitor activity. Acts upstream of or within response to bacterium. Located in external side of plasma membrane. Is expressed in alimentary system; hindlimb tendon; liver; metanephros; and physiological umbilical hernia. Used to study osteoporosis. Orthologous to human LY6H (lymphocyte antigen 6 family member H).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
