-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB22A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human RAB22A (NP_065724.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB22A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human RAB22A (NP_065724.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15352A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB22A |
| Target Synonyms | RAB22A; ras-related protein Rab-22A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-375, Jurkat, Mouse colon, Mouse testis, Rat testis, Rat uterus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human RAB22A (NP_065724.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MALRELKVCLLGDTGVGKSSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWV | Uniprot ID | Q9UL26 |
Uniprot Id
Q9UL26
Target Species
Human
Target Name
RAB22A
Target Full Name
Ras-related protein Rab-22A
Target Function
Plays a role in endocytosis and intracellular protein transport. Mediates trafficking of TF from early endosomes to recycling endosomes. Required for NGF-mediated endocytosis of NTRK1, and subsequent neurite outgrowth. Binds GTP and GDP and has low GTPase activity. Alternates between a GTP-bound active form and a GDP-bound inactive form.
Target Subcellular Location
Endosome membrane; Lipid-anchor. Cell membrane; Lipid-anchor. Early endosome. Late endosome. Cell projection, ruffle. Cytoplasmic vesicle. Cytoplasmic vesicle, phagosome. Cytoplasmic vesicle, phagosome membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Small GTPase superfamily, Rab family
Target Synonyms
3732413A17Rik; AI662177; AW319644; AW550514; E130120E14Rik; GTP binding protein RAB22A; MGC16770; OTTMUSP00000017605; Rab 22; RAB 22A; Rab-22; Rab22; RAB22A; RAB22A member RAS oncogene family; Ras related protein Rab 22A; Ras related protein Rab22A; Ras-related protein Rab-22A; RB22A_HUMAN
Target Background
The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosomal compartments.
Notification