-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Dectin-1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 66-247 of human Dectin-1 (NP_922938.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.
The antibody against Dectin-1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 66-247 of human Dectin-1 (NP_922938.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC, ELISA.
| Cat.No | ADA-15712A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Dectin-1 |
| Target Synonyms | CLEC7A; BGR; CANDF4; CD369; CLECSF12; DECTIN1; SCARE2; C-type lectin domain containing 7A; Dectin-1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 66-247 of human Dectin-1 (NP_922938.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TMAIWRSNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNLLKIDSSNELGFIVKQVSSQPDNSFWIGLSRPQTEVPWLWEDGSTFSSNLFQIRTTATQENPSPNCVWIHVSVIYDQLCSVPSYSICEKKFSM | Uniprot ID | Q9BXN2 |
Uniprot Id
Q9BXN2
Target Species
Human
Target Name
CLEC7A
Target Full Name
C-type lectin domain family 7 member A
Target Function
Lectin that functions as pattern recognizing receptor (PRR) specific for beta-1,3-linked and beta-1,6-linked glucans, which constitute cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and activation of NF-kappa-B: upon beta-glucan binding, recruits SYK via its ITAM motif and promotes a signaling cascade that activates some CARD domain-BCL10-MALT1 (CBM) signalosomes, leading to the activation of NF-kappa-B and MAP kinase p38 (MAPK11, MAPK12, MAPK13 and/or MAPK14) pathways which stimulate expression of genes encoding pro-inflammatory cytokines and chemokines. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation. Induces phosphorylation of SCIMP after binding beta-glucans.
Target Involvement
Candidiasis, familial, 4 (CANDF4)
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein.; [Isoform 5]: Cytoplasm.; [Isoform 6]: Cytoplasm.; [Isoform 7]: Cytoplasm.
Target Tissue Specificity
Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta.
Target Synonyms
Beta GR; Beta-glucan receptor; BGR; C type calcium dependent carbohydrate recognition domain lectin superfamily member 12; C type lectin domain family 7 member a; C-type lectin domain family 7 member A; C-type lectin superfamily member 12; CANDF4; CLC7A_HUMAN; CLEC7A; CLEC7A protein; Clecsf12; DC-associated C-type lectin 1; Dectin 1; DECTIN 1 receptor; Dectin-1; Dectin1; Dendritic cell associated C type lectin 1; Dendritic cell-associated C-type lectin 1; Lectin like receptor 1; Putative transmembrane protein dectin 1
Target Background
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. The encoded glycoprotein is a small type II membrane receptor with an extracellular C-type lectin-like domain fold and a cytoplasmic domain with an immunoreceptor tyrosine-based activation motif. It functions as a pattern-recognition receptor that recognizes a variety of beta-1, 3-linked and beta-1, 6-linked glucans from fungi and plants, and in this way plays a role in innate immune response. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region.
Notification