-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Doublecortin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Doublecortin (O43602) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Doublecortin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Doublecortin (O43602) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15968A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Doublecortin |
| Target Synonyms | DC; DBCN; LISX; SCLH; XLIS; Doublecortin | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Doublecortin (O43602). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MELDFGHFDERDKTSRNMRGSRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVYAVSSDRFRSFDALLADLTRSLSDNINLPQG | Uniprot ID | O43602 |
Uniprot Id
O43602
Target Species
Human
Target Name
DCX
Target Full Name
Neuronal migration protein doublecortin
Target Function
Microtubule-associated protein required for initial steps of neuronal dispersion and cortex lamination during cerebral cortex development. May act by competing with the putative neuronal protein kinase DCLK1 in binding to a target protein. May in that way participate in a signaling pathway that is crucial for neuronal interaction before and during migration, possibly as part of a calcium ion-dependent signal transduction pathway. May be part with PAFAH1B1/LIS-1 of overlapping, but distinct, signaling pathways that promote neuronal migration.
Target Involvement
Lissencephaly, X-linked 1 (LISX1); Subcortical band heterotopia X-linked (SBHX)
Target Subcellular Location
Cytoplasm. Cell projection, neuron projection.
Target Tissue Specificity
Highly expressed in neuronal cells of fetal brain (in the majority of cells of the cortical plate, intermediate zone and ventricular zone), but not expressed in other fetal tissues. In the adult, highly expressed in the brain frontal lobe, but very low ex
Target Research Area
Neuroscience
Target Synonyms
DBCN; Dbct; DC; DCX; DCX_HUMAN; Doublecortex; Doublin; FLJ51296; Lis X; Lis-X; Lissencephalin X; Lissencephalin-X; Lissencephaly X linked; Lissencephaly X linked doublecortin; LISX; Neuronal migration protein doublecortin; OTTHUMP00000023859; OTTHUMP00000023860; OTTHUMP00000216315; OTTHUMP00000216316; SCLH; XLIS
Target Background
This gene encodes a member of the doublecortin family. The protein encoded by this gene is a cytoplasmic protein and contains two doublecortin domains, which bind microtubules. In the developing cortex, cortical neurons must migrate over long distances to reach the site of their final differentiation. The encoded protein appears to direct neuronal migration by regulating the organization and stability of microtubules. In addition, the encoded protein interacts with LIS1, the regulatory gamma subunit of platelet activating factor acetylhydrolase, and this interaction is important to proper microtubule function in the developing cortex. Mutations in this gene cause abnormal migration of neurons during development and disrupt the layering of the cortex, leading to epilepsy, cognitive disability, subcortical band heterotopia ("double cortex" syndrome) in females and lissencephaly ("smooth brain" syndrome) in males. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification