-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against tPA/PLAT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 463-562 of human tPA/tPA/PLAT (P00750) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against tPA/PLAT was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 463-562 of human tPA/tPA/PLAT (P00750) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16051A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | tPA/PLAT |
| Target Synonyms | TPA; T-PA; tPA/PLAT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Human plasma, Mouse plasma, Rat lung, Rat plasma | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 463-562 of human tPA/tPA/PLAT (P00750). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP | Uniprot ID | P00750 |
Uniprot Id
P00750
Target Species
Human
Target Name
PLAT
Target Full Name
Tissue-type plasminogen activator
Target Function
Converts the abundant, but inactive, zymogen plasminogen to plasmin by hydrolyzing a single Arg-Val bond in plasminogen. By controlling plasmin-mediated proteolysis, it plays an important role in tissue remodeling and degradation, in cell migration and many other physiopathological events. During oocyte activation, plays a role in cortical granule reaction in the zona reaction, which contributes to the block to polyspermy.
Target Involvement
Increased activity of TPA results in increased fibrinolysis of fibrin blood clots that is associated with excessive bleeding. Defective release of TPA results in hypofibrinolysis that can lead to thrombosis or embolism.
Target Subcellular Location
Secreted, extracellular space.
Target Protein Families
Peptidase S1 family
Target Tissue Specificity
Synthesized in numerous tissues (including tumors) and secreted into most extracellular body fluids, such as plasma, uterine fluid, saliva, gingival crevicular fluid, tears, seminal fluid, and milk.
Target Research Area
Cancer
Target Synonyms
Alteplase; DKFZp686I03148; Plasminogen activator tissue; Plasminogen activator tissue type; PLAT; Reteplase; t PA; T Plasminogen Activator; t-PA; T-plasminogen activator; Tissue plasminogen activator (t PA); Tissue type plasminogen activator; Tissue-type plasminogen activator chain B; tPA; TPA_HUMAN; TPA1
Target Background
This gene encodes tissue-type plasminogen activator, a secreted serine protease that converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. The encoded preproprotein is proteolytically processed by plasmin or trypsin to generate heavy and light chains. These chains associate via disulfide linkages to form the heterodimeric enzyme. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding, while decreased activity leads to hypofibrinolysis, which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed.
Notification