-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CDC27 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 702-824 of human CDC27 (P30260) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CDC27 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 702-824 of human CDC27 (P30260) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16183A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CDC27 |
| Target Synonyms | APC3; HNUC; NUC2; H-NUC; ANAPC3; CDC27Hs; D0S1430E; D17S978E; CDC27 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU-145, Mouse testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 702-824 of human CDC27 (P30260). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NPLCKFHRASVLFANEKYKSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAIDKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF | Uniprot ID | P30260 |
Uniprot Id
P30260
Target Species
Human
Target Name
CDC27
Target Full Name
Cell division cycle protein 27 homolog
Target Function
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, spindle.
Target Protein Families
APC3/CDC27 family
Target Synonyms
ANAPC3; Anaphase Promoting Complex 3; Anaphase promoting complex protein 3; Anaphase Promoting Complex Subunit 3; Anaphase-promoting complex subunit 3; APC 3; APC3; Cdc 27; Cdc27; CDC27 homolog; CDC27_HUMAN; CDC27Hs; Cell Division Cycle 27; Cell division cycle protein 27 homolog; D0S1430E; D17S978E; H NUC; H-NUC; HNUC; Nuc2 homolog
Target Background
The protein encoded by this gene shares strong similarity with Saccharomyces cerevisiae protein Cdc27, and the gene product of Schizosaccharomyces pombe nuc 2. This protein is a component of the anaphase-promoting complex (APC), which is composed of eight protein subunits and is highly conserved in eukaryotic cells. This complex catalyzes the formation of cyclin B-ubiquitin conjugate, which is responsible for the ubiquitin-mediated proteolysis of B-type cyclins. The protein encoded by this gene and three other members of the APC complex contain tetratricopeptide (TPR) repeats, which are important for protein-protein interactions. This protein was shown to interact with mitotic checkpoint proteins including Mad2, p55CDC and BUBR1, and it may thus be involved in controlling the timing of mitosis. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 2, 22 and Y.
Notification