-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Hsc70/HSPA8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 547-646 of human Hsc70/HSPA8 (P11142) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Hsc70/HSPA8 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 547-646 of human Hsc70/HSPA8 (P11142) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16456A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Hsc70/HSPA8 |
| Target Synonyms | LAP1; HSC54; HSC70; HSC71; HSP71; HSP73; LAP-1; NIP71; HEL-33; HSPA10; HEL-S-72p; Hsc70/HSPA8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat brain, 293T, Mouse brain, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 547-646 of human Hsc70/HSPA8 (P11142). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELEKVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD | Uniprot ID | P11142 |
Uniprot Id
P11142
Target Species
Human
Target Name
HSPA8
Target Full Name
Heat shock cognate 71 kDa protein
Target Function
Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The co-chaperones have been shown to not only regulate different steps of the ATPase cycle of HSP70, but they also have an individual specificity such that one co-chaperone may promote folding of a substrate while another may promote degradation. The affinity of HSP70 for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. HSP70 goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release. The HSP70-associated co-chaperones are of three types: J-domain co-chaperones HSP40s (stimulate ATPase hydrolysis by HSP70), the nucleotide exchange factors (NEF) such as BAG1/2/3 (facilitate conversion of HSP70 from the ADP-bound to the ATP-bound state thereby promoting substrate release), and the TPR domain chaperones such as HOPX and STUB1. Plays a critical role in mitochondrial import, delivers preproteins to the mitochondrial import receptor TOMM70. Acts as a repressor of transcriptional activation. Inhibits the transcriptional coactivator activity of CITED1 on Smad-mediated transcription. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. Binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Participates in the ER-associated degradation (ERAD) quality control pathway in conjunction with J domain-containing co-chaperones and the E3 ligase STUB1. Interacts with VGF-derived peptide TLQP-21.
Target Subcellular Location
Cytoplasm. Melanosome. Nucleus, nucleolus. Cell membrane. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Translocates rapidly from the cytoplasm to the nuclei, and especially to the nucleoli, upon heat shock.
Target Protein Families
Heat shock protein 70 family
Target Tissue Specificity
Ubiquitous.
Target Research Area
Signal Transduction
Target Synonyms
2410008N15Rik; Constitutive heat shock protein 70; Epididymis luminal protein 33; Epididymis secretory sperm binding protein Li 72p; Heat shock 70 kDa protein 8; Heat shock 70kD protein 10; Heat shock 70kD protein 8; Heat shock 70kDa protein 8; Heat shock cognate 71 kDa protein; Heat shock cognate protein 54; Heat shock cognate protein 71 kDa; Heat shock protein 8; Heat shock protein A8; Heat shock protein family A (Hsp70) member 8; Heat-shock70-KD protein 10, formerly; HEL 33; HEL S 72p; HSC54; HSC71; Hsc73; HSP71; HSP73; HSP7C_HUMAN; HSPA10; HSPA8; LAP1; Lipopolysaccharide associated protein 1; LPS associated protein 1; LPS associated protein; MGC102007; MGC106514; MGC114311; MGC118485; MGC131511; MGC29929; N-myristoyltransferase inhibitor protein 71; NIP71
Target Background
This gene encodes a member of the heat shock protein 70 family, which contains both heat-inducible and constitutively expressed members. This protein belongs to the latter group, which are also referred to as heat-shock cognate proteins. It functions as a chaperone, and binds to nascent polypeptides to facilitate correct folding. It also functions as an ATPase in the disassembly of clathrin-coated vesicles during transport of membrane components through the cell. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification