Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ADAMTS13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ADAMTS13 (Q76LX8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ADAMTS13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human ADAMTS13 (Q76LX8) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13502A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ADAMTS13 |
| Target Synonyms | VWFCP; C9orf8; vWF-CP; ADAM-TS13; ADAMTS-13; ADAMTS13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse plasma, Mouse spleen, Rat plasma | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human ADAMTS13 (Q76LX8). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSPGAPLKGRPPSPGFQRQRQRQRRAAGGILHLELLVAVGPDVFQAHQEDTERYVLTNLNIGAELLRDPSLGAQFRVHLVKMVILTEPEGAPNITANLTSS | Uniprot ID | Q76LX8 |
Uniprot Id
Q76LX8
Target Species
Human
Target Name
ADAMTS13
Target Full Name
A disintegrin and metalloproteinase with thrombospondin motifs 13
Target Function
Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.
Target Involvement
Thrombotic thrombocytopenic purpura congenital (TTP)
Target Subcellular Location
Secreted. Note=Secretion enhanced by O-fucosylation of TSP type-1 repeats.
Target Tissue Specificity
Plasma. Expressed primarily in liver.
Target Synonyms
A disintegrin and metalloproteinase with thrombospondin motifs 13; A disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif 13; A disintegrin like and metalloprotease with thrombospondin type 1 motif 13; ADAM metallopeptidase with thrombospondin type 1 motif 13; ADAM TS; ADAM-TS 13; ADAM-TS13; ADAMTS 13; ADAMTS-13; ADAMTS13; ADAMTS13 protein; ATS13_HUMAN; C9orf8; TTP; Von Willebrand factor cleaving protease; von Willebrand factor-cleaving protease; vWF cleaving protease; vWF CP; vWF-cleaving protease; vWF-CP; vWFCP
Target Background
This gene encodes a member of a family of proteins containing several distinct regions, including a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. The enzyme encoded by this gene specifically cleaves von Willebrand Factor (vWF). Defects in this gene are associated with thrombotic thrombocytopenic purpura. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
