-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALDOA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aldolase (P04075) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ALDOA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aldolase (P04075) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16717A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALDOA |
| Target Synonyms | ALDA; GSD12; HEL-S-87p; ALDOA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, Jurkat, Mouse brain | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aldolase (P04075). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKS | Uniprot ID | P04075 |
Uniprot Id
P04075
Target Species
Human
Target Name
ALDOA
Target Full Name
Fructose-bisphosphate aldolase A
Target Function
Plays a key role in glycolysis and gluconeogenesis. In addition, may also function as scaffolding protein.
Target Involvement
Glycogen storage disease 12 (GSD12)
Target Subcellular Location
Cytoplasm, myofibril, sarcomere, I band. Cytoplasm, myofibril, sarcomere, M line.
Target Protein Families
Class I fructose-bisphosphate aldolase family
Target Research Area
Metabolism
Target Synonyms
ALDA; Aldo1; ALDOA; ALDOA_HUMAN; Aldolase 1; Aldolase A; Aldolase A fructose bisphosphatase; Aldolase A fructose bisphosphate; Aldolase; fructose-bisphosphate A; Epididymis secretory sperm binding protein Li 87p; FRUCTOALDOLASE A; Fructose 1 6 bisphosphate triosephosphate lyase; Fructose bisphosphate aldolase A; Fructose bisphosphate aldolase; FRUCTOSE-1,6-BISPHOSPHATE ALDOLASE A; Fructose-bisphosphate aldolase A; Fructose-bisphosphate aldolase A Muscle-type; GSD12; HEL S 87p; Lung cancer antigen NY LU 1; Lung cancer antigen NY-LU-1; MGC10942; MGC17716; MGC17767; Muscle type aldolase; Muscle-type aldolase; RNALDOG5
Target Background
This gene encodes a member of the class I fructose-bisphosphate aldolase protein family. The encoded protein is a glycolytic enzyme that catalyzes the reversible conversion of fructose-1, 6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Three aldolase isozymes (A, B, and C), encoded by three different genes, are differentially expressed during development. Mutations in this gene have been associated with Glycogen Storage Disease XII, an autosomal recessive disorder associated with hemolytic anemia. Disruption of this gene also plays a role in the progression of multiple types of cancers. Related pseudogenes have been identified on chromosomes 3 and 10.
Notification