-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CaMK2 delta/CAMK2 gamma was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMK2 delta/CAMK2 gamma (Q13554) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against CaMK2 delta/CAMK2 gamma was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMK2 delta/CAMK2 gamma (Q13554) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-14104A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CaMK2 delta/CAMK2 gamma |
| Target Synonyms | CAM2; CAMK2; CAMKB; MRD54; CaMKIIbeta; CaMK2 delta/CAMK2 gamma | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, RD, U-251MG | Application | ELISA, WB, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CaMK2 delta/CAMK2 gamma (Q13554). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL | Uniprot ID | Q13554 |
Uniprot Id
Q13554
Target Species
Human
Target Name
CAMK2B
Target Full Name
Calcium/calmodulin-dependent protein kinase type II subunit beta
Target Function
Calcium/calmodulin-dependent protein kinase that functions autonomously after Ca(2+)/calmodulin-binding and autophosphorylation, and is involved in dendritic spine and synapse formation, neuronal plasticity and regulation of sarcoplasmic reticulum Ca(2+) transport in skeletal muscle. In neurons, plays an essential structural role in the reorganization of the actin cytoskeleton during plasticity by binding and bundling actin filaments in a kinase-independent manner. This structural function is required for correct targeting of CaMK2A, which acts downstream of NMDAR to promote dendritic spine and synapse formation and maintain synaptic plasticity which enables long-term potentiation (LTP) and hippocampus-dependent learning. In developing hippocampal neurons, promotes arborization of the dendritic tree and in mature neurons, promotes dendritic remodeling. Also regulates the migration of developing neurons. Participates in the modulation of skeletal muscle function in response to exercise. In slow-twitch muscles, is involved in regulation of sarcoplasmic reticulum (SR) Ca(2+) transport and in fast-twitch muscle participates in the control of Ca(2+) release from the SR through phosphorylation of triadin, a ryanodine receptor-coupling factor, and phospholamban (PLN/PLB), an endogenous inhibitor of SERCA2A/ATP2A2.
Target Subcellular Location
Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Sarcoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction, synapse. Note=In slow-twitch muscle, evenly distributed between longitudinal SR and junctional SR.
Target Protein Families
Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Target Tissue Specificity
Widely expressed. Expressed in adult and fetal brain. Expression is slightly lower in fetal brain. Expressed in skeletal muscle.
Target Synonyms
Calcium/calmodulin dependent protein kinase (CaM kinase) II beta; Calcium/calmodulin dependent protein kinase II beta; Calcium/calmodulin dependent protein kinase IIB; Calcium/calmodulin dependent protein kinase type II beta chain; calcium/calmodulin-dependent protein kinase II beta; Calcium/calmodulin-dependent protein kinase type II subunit beta; CAM 2; CaM kinase II beta chain; CaM kinase II beta subunit; CaM kinase II subunit beta; CaM-kinase II beta chain; CAM2; CAMK 2; CAMK 2B; CaMK II beta subunit; CaMK II subunit beta; CaMK-II subunit beta; CAMK2; CaMK2 beta; Camk2b; CAMKB; CaMKII beta subunit; CaMKIIB; KCC2B_HUMAN; MGC29528; Proline rich calmodulin dependent protein kinase; proline rich calmodulin-dependent protein kinase
Target Background
The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants.
Notification