-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD45 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 194-390 of human CD45 (NP_002829.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CD45 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 194-390 of human CD45 (NP_002829.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16541A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD45 |
| Target Synonyms | LCA; LY5; B220; CD45; L-CA; T200; CD45R; GP180; IMD105 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat cells | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 194-390 of human CD45 (NP_002829.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SDAYLNASETTTLSPSGSAVISTTTIATTPSKPTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVPPGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNNHKFTNASKIIKTDFG | Uniprot ID | P08575 |
Uniprot Id
P08575
Target Species
Human
Target Name
PTPRC
Target Full Name
Receptor-type tyrosine-protein phosphatase C
Target Function
Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN. Dephosphorylates LYN, and thereby modulates LYN activity.; (Microbial infection) Acts as a receptor for human cytomegalovirus protein UL11 and mediates binding of UL11 to T-cells, leading to reduced induction of tyrosine phosphorylation of multiple signaling proteins upon T-cell receptor stimulation and impaired T-cell proliferation.
Target Involvement
Severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (T(-)B(+)NK(+) SCID); Multiple sclerosis (MS)
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft.
Target Protein Families
Protein-tyrosine phosphatase family, Receptor class 1/6 subfamily
Target Tissue Specificity
Isoform 1: Detected in thymocytes. Isoform 2: Detected in thymocytes. Isoform 3: Detected in thymocytes. Isoform 4: Not detected in thymocytes. Isoform 5: Detected in thymocytes. Isoform 6: Not detected in thymocytes. Isoform 7: Detected in thymocytes. Is
Target Research Area
Immunology
Target Synonyms
B220; CD 45; CD45; CD45 antigen; CD45R; GP180; L-CA; LCA; Leukocyte common antigen; loc; Ly-5; LY5; Ly5, homolog of; Lyt-4; OTTHUMP00000033813; OTTHUMP00000033816; OTTHUMP00000033817; OTTHUMP00000038574; Protein tyrosine phosphatase receptor type c polypeptide; Protein tyrosine phosphatase, receptor type C; protein tyrosine phosphatase, receptor type, C; Protein tyrosine phosphatase, receptor type, c polypeptide; Ptprc; PTPRC_HUMAN; Receptor-type tyrosine-protein phosphatase C; T200; T200 glycoprotein; T200 leukocyte common antigen
Target Background
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. This PTP also suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Alternatively spliced transcripts variants of this gene, which encode distinct isoforms, have been reported.
Notification