-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CHM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHM (P24386) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CHM was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHM (P24386) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13208A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CHM |
| Target Synonyms | TCD; GGTA; REP-1; DXS540; HSD-32; CHM | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHM (P24386). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MADTLPSEFDVIVIGTGLPESIIAAACSRSGRRVLHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEEAIALSRKDKTIQHVEV | Uniprot ID | P24386 |
Uniprot Id
P24386
Target Species
Human
Target Name
CHM
Target Full Name
Rab proteins geranylgeranyltransferase component A 1
Target Function
Substrate-binding subunit of the Rab geranylgeranyltransferase (GGTase) complex. Binds unprenylated Rab proteins and presents the substrate peptide to the catalytic component B composed of RABGGTA and RABGGTB, and remains bound to it after the geranylgeranyl transfer reaction. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane. Besides, a pre-formed complex consisting of CHM and the Rab GGTase dimer (RGGT or component B) can bind to and prenylate Rab proteins; this alternative pathway is proposed to be the predominant pathway for Rab protein geranylgeranylation.
Target Involvement
Choroideremia (CHM)
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Rab GDI family
Target Research Area
Neuroscience
Target Synonyms
HM; Chm; Choroideraemia protein; Choroideremia; DXS540; FLJ38564; GGTA; HSD 32; MGC102710; Rab escort protein 1; Rab geranylgeranyltransferase component A; Rab proteins geranylgeranyltransferase component A 1; RAE1_HUMAN; REP 1; REP-1; REP1; TCD; TCD protein
Target Background
This gene encodes component A of the RAB geranylgeranyl transferase holoenzyme. In the dimeric holoenzyme, this subunit binds unprenylated Rab GTPases and then presents them to the catalytic Rab GGTase subunit for the geranylgeranyl transfer reaction. Rab GTPases need to be geranylgeranyled on either one or two cysteine residues in their C-terminus to localize to the correct intracellular membrane. Mutations in this gene are a cause of choroideremia; also known as tapetochoroidal dystrophy (TCD). This X-linked disease is characterized by progressive dystrophy of the choroid, retinal pigment epithelium and retina. Alternatively spliced transcript variants have been found for this gene.
Notification