-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against cIAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human cIAP1 (Q13490) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against cIAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human cIAP1 (Q13490) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-17218A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | cIAP1 |
| Target Synonyms | API1; MIHB; HIAP2; RNF48; cIAP1; Hiap-2; c-IAP1; P1 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, BxPC-3, HepG2, Jurkat | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human cIAP1 (Q13490). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPI | Uniprot ID | Q13490 |
Uniprot Id
Q13490
Target Species
Human
Target Name
BIRC2
Target Full Name
Baculoviral IAP repeat-containing protein 2
Target Function
Multi-functional protein which regulates not only caspases and apoptosis, but also modulates inflammatory signaling and immunity, mitogenic kinase signaling, and cell proliferation, as well as cell invasion and metastasis. Acts as an E3 ubiquitin-protein ligase regulating NF-kappa-B signaling and regulates both canonical and non-canonical NF-kappa-B signaling by acting in opposite directions: acts as a positive regulator of the canonical pathway and suppresses constitutive activation of non-canonical NF-kappa-B signaling. The target proteins for its E3 ubiquitin-protein ligase activity include: RIPK1, RIPK2, RIPK3, RIPK4, CASP3, CASP7, CASP8, TRAF2, DIABLO/SMAC, MAP3K14/NIK, MAP3K5/ASK1, IKBKG/NEMO, IKBKE and MXD1/MAD1. Can also function as an E3 ubiquitin-protein ligase of the NEDD8 conjugation pathway, targeting effector caspases for neddylation and inactivation. Acts as an important regulator of innate immune signaling via regulation of Toll-like receptors (TLRs), Nodlike receptors (NLRs) and RIG-I like receptors (RLRs), collectively referred to as pattern recognition receptors (PRRs). Protects cells from spontaneous formation of the ripoptosome, a large multi-protein complex that has the capability to kill cancer cells in a caspase-dependent and caspase-independent manner. Suppresses ripoptosome formation by ubiquitinating RIPK1 and CASP8. Can stimulate the transcriptional activity of E2F1. Plays a role in the modulation of the cell cycle.
Target Subcellular Location
Cytoplasm. Nucleus. Note=Agents that induce either the extrinsic or intrinsic apoptotic pathways promote its redistribution from the nuclear compartment to the cytoplasmic compartment. Associated with the midbody in telophase cells, and found diffusely in the nucleus of interphase cells.
Target Protein Families
IAP family
Target Tissue Specificity
Present in many fetal and adult tissues. Mainly expressed in adult skeletal muscle, thymus, testis, ovary, and pancreas, low or absent in brain and peripheral blood leukocytes.
Target Synonyms
API 1; API1; Apoptosis inhibitor 1; Baculoviral IAP repeat containing 2; Baculoviral IAP repeat containing protein 2; Baculoviral IAP repeat-containing protein 2; BIRC 2; BIRC2; BIRC2_HUMAN; C IAP1; C-IAP1; Cellular inhibitor of apoptosis 1; cellular inhibitor of apoptosis protein 1; cIAP 1; cIAP1; HIAP 2; HIAP-2; HIAP2; IAP 2; IAP homolog B; IAP-2; IAP2; Inhibitor of apoptosis protein 2; MIHB; NFR2 TRAF signalling complex protein; RING finger protein 48; RNF 48; RNF48; TNFR2 TRAF signaling complex protein 2; TNFR2-TRAF-signaling complex protein 2
Target Background
The protein encoded by this gene is a member of a family of proteins that inhibits apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. This encoded protein inhibits apoptosis induced by serum deprivation and menadione, a potent inducer of free radicals. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification