-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CSK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CSK (P41240) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against CSK was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human CSK (P41240) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14120A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CSK |
| Target Synonyms | CSK; tyrosine-protein kinase CSK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, A549, Jurkat, Mouse spleen, Mouse thymus, Raji, Rat lung, Rat spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CSK (P41240). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE | Uniprot ID | P41240 |
Uniprot Id
P41240
Target Species
Human
Target Name
CSK
Target Full Name
Tyrosine-protein kinase CSK
Target Function
Non-receptor tyrosine-protein kinase that plays an important role in the regulation of cell growth, differentiation, migration and immune response. Phosphorylates tyrosine residues located in the C-terminal tails of Src-family kinases (SFKs) including LCK, SRC, HCK, FYN, LYN, CSK or YES1. Upon tail phosphorylation, Src-family members engage in intramolecular interactions between the phosphotyrosine tail and the SH2 domain that result in an inactive conformation. To inhibit SFKs, CSK is recruited to the plasma membrane via binding to transmembrane proteins or adapter proteins located near the plasma membrane. Suppresses signaling by various surface receptors, including T-cell receptor (TCR) and B-cell receptor (BCR) by phosphorylating and maintaining inactive several positive effectors such as FYN or LCK.
Target Subcellular Location
Cytoplasm. Cell membrane.
Target Protein Families
Protein kinase superfamily, Tyr protein kinase family, CSK subfamily
Target Tissue Specificity
Expressed in lung and macrophages.
Target Synonyms
C SRC; C SRC kinase; C src Tyrosine Kinase; C-SRC kinase; c-src tyrosine kinase; Csk A; CSK; CSK_HUMAN; CYTOPLASMIC TYROSINE KINASE; EC 2.7.10.2; MGC112926; MGC117393; MGC154049; P60 Src; Protein tyrosine kinase CYL; Protein-tyrosine kinase CYL; Proto oncogene tyrosine protein kinase; Tyrosine protein kinase CSK; Tyrosine-protein kinase CSK; zgc:154049
Target Background
The protein encoded by this gene is involved in multiple pathways, including the regulation of Src family kinases. It plays an important role in T-cell activation through its association with the protein encoded by the protein tyrosine phosphatase, non-receptor type 22 (PTPN22) gene. This protein also phosphorylates C-terminal tyrosine residues on multiple substrates, including the protein encoded by the SRC proto-oncogene, non-receptor tyrosine kinase gene. Phosphorylation suppresses the kinase activity of the Src family tyrosine kinases. An intronic polymorphism (rs34933034) in this gene has been found to affect B-cell activation and is associated with systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants.
Notification