-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CYP1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CYP1A1 (NP_000490.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CYP1A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-350 of human CYP1A1 (NP_000490.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16830A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CYP1A1 |
| Target Synonyms | AHH; AHRR; CP11; CYP1; CYPIA1; P1-450; P450-C; P450DX; CYP1A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Hep G2 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CYP1A1 (NP_000490.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV | Uniprot ID | P04798 |
Uniprot Id
P04798
Target Species
Human
Target Name
CYP1A1
Target Full Name
Cytochrome P450 1A1
Target Function
A cytochrome P450 monooxygenase involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (NADPH--hemoprotein reductase). Catalyzes the hydroxylation of carbon-hydrogen bonds. Exhibits high catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta-estradiol (E2), namely 2-hydroxy E1 and E2, as well as D-ring hydroxylated E1 and E2 at the C15-alpha and C16-alpha positions. Displays different regioselectivities for polyunsaturated fatty acids (PUFA) hydroxylation. Catalyzes the epoxidation of double bonds of certain PUFA. Converts arachidonic acid toward epoxyeicosatrienoic acid (EET) regioisomers, 8,9-, 11,12-, and 14,15-EET, that function as lipid mediators in the vascular system. Displays an absolute stereoselectivity in the epoxidation of eicosapentaenoic acid (EPA) producing the 17(R),18(S) enantiomer. May play an important role in all-trans retinoic acid biosynthesis in extrahepatic tissues. Catalyzes two successive oxidative transformation of all-trans retinol to all-trans retinal and then to the active form all-trans retinoic acid. May also participate in eicosanoids metabolism by converting hydroperoxide species into oxo metabolites (lipoxygenase-like reaction, NADPH-independent).
Target Subcellular Location
Endoplasmic reticulum membrane; Peripheral membrane protein. Mitochondrion inner membrane; Peripheral membrane protein. Microsome membrane; Peripheral membrane protein. Cytoplasm.
Target Protein Families
Cytochrome P450 family
Target Tissue Specificity
Lung, lymphocytes and placenta.
Target Research Area
Cancer
Target Synonyms
AHH; AHRR; Aryl hydrocarbon hydroxylase; CP11; CP1A1_HUMAN; CYP 1; CYP1; cyp1a1; CYPIA1; Cytochrome P1 450 dioxin inducible; Cytochrome P1-450; Cytochrome P450 1A1; Cytochrome P450 family 1 subfamily A polypeptide 1; Cytochrome P450 form 6; Cytochrome P450 subfamily I (aromatic compound inducible) polypeptide 1; Cytochrome P450-C; Cytochrome P450-P1; Flavoprotein-linked monooxygenase; Microsomal monooxygenase; P1 450; P450 C; P450 form 6; P450 P1; P450DX; Xenobiotic monooxygenase
Target Background
This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Notification